KEGG   Corallococcus coralloides: COCOR_04378Help
Entry
COCOR_04378       CDS       T01780                                 

Gene name
aroH
Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01130  Biosynthesis of antibiotics
ccx01230  Biosynthesis of amino acids
ccx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COCOR_04378 (aroH)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    COCOR_04378 (aroH)
Enzymes [BR:ccx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     COCOR_04378 (aroH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AFE08099
UniProt: H8N1Z0
LinkDB All DBs
Position
5505591..5506871
Genome map
AA seq 426 aa AA seqDB search
MTNTSWSPSSWRAKPVRYIPDDYPDLSALARVEAELARLPPLVHAEETRRLREALGQVAE
GKAFLLQGGDCAESFKEFSAENVRGTFQLLLQMAGVLTFAGGCPVVKVGRIAGQFAKPRS
NATETVNGVTLPSYRGDIINGMDFDARERTPDPQRLLRAYHQSAETMQLVRAFAREGYTD
LTRLLGHRPESEGAVRPVDFFTSHEALLLNVEQAMTRVDEATGGWYDASAHMLWIGERTR
QLDGGHVEFMRGIQNPIGLKCGPTLEPDDLVRLIDTLNPQGIPGKLTLIGRFGSDQVAAR
LPRLMAATRRHGSPVVWSIDPMHGNTHKASNGYKTRSLERILAEVMGFLQVAAAEGVHPG
GLHLEMTGQDVTECLGGPLDVSEDDLSDRYHTHCDPRLNADQSLQLAFRVADGLHTTVRT
PQDRAA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaatacctcctggtccccctcctcctggcgggcgaagccggtccgctacatcccg
gacgactaccccgacctgtccgccctcgcgcgcgtggaggcggagctggcgcgcctgccg
ccgctggtgcacgccgaagagacccgccgtctgcgggaagccctgggccaggtggccgag
ggcaaggccttcctgctccagggcggcgactgcgcggagagcttcaaggagttctccgcg
gagaacgtgcgcggcaccttccagctgctgctccagatggcgggcgtgctcacgttcgcg
ggcggctgcccggtggtgaaggtgggccgcatcgcgggccagttcgccaagccgcgctcc
aatgccacggagaccgtcaacggcgtcacgctgcccagctaccgcggcgacatcatcaac
ggcatggacttcgacgcgcgcgagcgcacgccggatccccagcgcctgctgcgcgcgtat
caccagtccgcggagacgatgcagctggtgcgggccttcgcgcgcgagggctacacggac
ctgacccggctgttgggccaccggccggagtccgaaggcgccgtgcgcccggtggacttc
ttcaccagccacgaagccctgctcctcaacgtcgagcaggccatgacgcgcgtcgatgag
gccacgggcggctggtacgacgcgtccgcgcacatgctctggattggtgagcgcacccgc
cagttggacggcggccacgtggagttcatgcgcggcatccagaaccccatcgggctcaag
tgcggccccacgctggagccggacgacctggtccgcctcatcgacacgctcaacccccag
ggcatccccggcaagctcacgctcatcgggcgcttcggttcggatcaggtcgccgcgcgc
ctgccccggttgatggccgccacccggcgccacggcagccccgtggtgtggtccatcgac
ccgatgcacggcaacacgcacaaggccagcaacggctacaagacgcgctcgctggagcgg
atcctcgcggaggtgatgggcttcctccaggtcgccgccgccgagggcgtgcaccccgga
ggcctccacctggagatgaccggccaggacgtcaccgagtgcctgggcggcccgctcgac
gtgtccgaggacgacctctccgaccgctaccacacgcactgcgatccgcgcctcaacgcg
gaccagtcgctccagctcgcgttccgcgtcgcggacggcctccacaccaccgtgcgcacc
cctcaagaccgcgctgcctga

DBGET integrated database retrieval system