KEGG   Corallococcus coralloides: COCOR_04396Help
Entry
COCOR_04396       CDS       T01780                                 

Gene name
lgrC2
Definition
(GenBank) non-ribosomal peptide synthase
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFE09205
UniProt: H8N208
LinkDB All DBs
Position
complement(5541733..5557986)
Genome map
AA seq 5417 aa AA seqDB search
MSPASPRPSSFSVFAQHPPFQSLVELLRHRGADAAHASRYTFLGETGELEASWTHAELDL
YARRIAGALAGVEPGARAVLLYPPGLDYIAGFFGCLYAGLVAVPAYPPDPSRLERTLPRL
RAIIEDSRATVVLTTSFILSMKEFLTDQAPELNGLHWAATDALEPGAEDGWRPPVARPDT
LAFLQYTSGSTGMPKGVMLTHGNLLHNLDAIHRSFRASADSVGVIWLPPYHDMGLIGGIL
EPLNGGFPVTLMSPLTFLRRPLVWLEAISQYKGTISGGPNFAFDLCARRISEEDRARLDL
SSWEVAFCGAEPIRTETLERFNRTFGPQGFRAPSLYPCYGLAEGTLIATGVTQGAGASAL
TLEAEALARSRAVRVEPGTPGSRELVGCGRSMADQSMLIVDPEARTPRADGEVGEIWLRG
PSIAQGYWQRPEQTEEAFQARLAGTGEGPFLRTGDLGFVVDGELYVTGRRKDLIILRGRN
HYPQDLELTAERAHPAIRPGSGAAFSVDVAGEERLVQVHEVSLRDGVDLGPVLAAVRQAL
SEEHELQPHALLLVEPGSVPKTSSGKIQRRACRESFLDGSLRVVTQWKEGGALEAHADVQ
EDAAPGDTAESMGAWLRSRVAARLRVRPDEVSSTEPITRLGLDSLAAVELSHDIEKGLGI
ILPMEALLQGPTIAELAGRVLAHRAGSNRLAPPALKPRTREELPALSFAQQRLWFLDALV
RGSPAYHIPVAVRLVGPLDVPALQHALDVLVRRHETLRTTFVSRDGVPAQRIHPDLPVTL
EPVDVSGREDRAQETARLARVEAARSFDLETGPLMRALLVKEGEGEHVLVVVMHHIVSDG
WSMGVMVREVGKAYEAKVKGEEWREAALDVQYADWAAWQREWLEGGALEEQLGWWKQQLA
GAPAALELPTDKPRPVNPTFRAHNVDASLSRSLSEAVKGLARQEGVTPFMVLLAAWQLVL
AKHAGQDDVSVGTPIAGRQRAETEGLIGFFVNTLVLRTRVESGASFRELLAQVRETTLGA
YAHQDVPFEKLVEALQPARDLARHPLFQVMLAFQQDSLPELKLPGLALRAVPLDSGAVKF
DLSLNLSETAEGFTGTLISSADLFHRASTERMVRHWHTLLEAATVQPGLRVDALPLLDEE
ARRSVLEAWPEERLEAGDDTCLHALFEAQAARVPDDVAVMGGGQSLTYRALDAGANQLAG
ALRAMGVGPDARVGLCVDRRADAMRGLLGILKAGGAYVPLDPANPGERLRLMLDEARVDV
VVTIRELASRFDGHPGRLVLLDDGEAPFASFPSDAPPVRGAVPSNLAYVIFTSGSTGRPR
SVGIEHRHIVRYVRGLVRRLDLAQGASFASVSTLAADLGHTALFPTLAQGGTLHLVDTET
ASDPAALGAYFARHGVEGLKIVPSHLRALLASESPERLLPRRWLVLGGESSDWALVDQVR
SLVPGCAVFNHYGPTETTVGVLTLPASAQAREDRPVVVPLGRPLPEVRAYVLDAGLRPVP
PGVAGGLYIAGGTVGRGYLGRPELTADRFIPSPFAKTPGERMYRTGDRARLGPDGAIVFL
GREDDQLKVRGFRVEPGEVEAVLKQHPAIAEAVVVARDAGGGERRLVAYAVPATGGQLGP
DLLKTFLEERLPSYLVPSAVVVLETLPLTANGKVERRALPEPAGFARAEPSAPGTPYEAL
LASVWAQVLGVSDVGPDDDFFERGGHSLLATRAVSRIRSVFQVDLPLRALFETPKLGALA
RRLEALSRTGADAVRPPVVPVPRDRPLPLSFAQQRLWFLDRMEPGNALYNVPAMLWLEGA
LDAEALERSLAEILLRHEVLRTTFHETPDGAVQRVAAAPARALTHVDLRDVAPDALEARA
REWAREDASRPFDLVTGPPVRMALLTLRDDRHVLVLVMHHIVADGWSLGVLVRELGALYG
AFTRGTASGLPALAVQYADHAVWQRGWLQGAVRDAQLSWWREQLQDAPRVLDLPLARHRP
KVRTSQGAQAMHVLPRATAESVRQLALREGATPFMVMMAAFQALLHRYTGRTDLLVGTDI
ANRHHAETEALVGFFVNQVVLRTRPTPVLPFRALLGQVREAALGAYAHQDLPFEELVRDL
NPERSLSASPLFQVKLIFQNARDAELALPGLSLRVESIDPGASKFDLTVAFSDTAEGLSG
LWEYSTDLFDAVTVARMQEHLRTLLEGALSRPDGALETLPLLTEAERAHVLGTWNAATLP
IGEPLRVHRRFEAAVEAFGDRPALRFEGQELSYRELEARSNALARHLRAQGVGLETRVGI
CLERSPELVVAMLATLKAGGAFVPLDPAYPSARLTFMLQDSAVPVVVTRSELADELPATG
AHLVCLDEDAARLERLPGTPLEDAGAPGHLAYVIYTSGSTGRPKGTLLTHGGLCNTAVAV
GRAHGVHPDSRVLQFASSSFDAGVCEVFSTLLSGACLVLAPKDALLPGPALERTLTEQAI
TTVTLTPSVLAQQSPEGLTRLETIISAGEACPPEVVRRWSPGRRFINAYGPTEITVCATL
TDQPLSADRVTIGGPLANVRVYVLSPALLPVPPGVPGELYVGGAGVGRGYLGHPSLTAER
FIPDPFSPEPGARMYRTGDRVRWLEVGALEFLGRSDSQVKVRGFRIELEEVEAVLGAQPG
VQAAAATVREEASGVRRLVGYVVPFEGAAPDEASLREGLRRRLPEHMVPAAFVVLDALPL
SPNGKVDRNALPALGGRPAREETPFVEPSTPAELLLASLWQQILRVERVGADDNFFELGG
DSIISLQVVAQARRAGLAITPKQLFEHQKLRDLAAAATLDATPAVADAGPVSGTVPLTPI
QRWFLEQGSPAPEHYNQAVLLGARESLDAGLVEAALRALWRHHDALRLRFTRACDGWSQQ
YGSPDEAVDFLVREDLSGLPEEAREARLEQVATRVQGSLDLGSGPLMRAVLFTMGTGQPA
RLLWVIHHLVVDGVSWRTLLEDFESAYLALRNGQAPALPPRTTSFKTWAERLEAYAATDA
VAAEADVWRAQAHVPVEPLPLDGPGGENTVASARTVSVELDAETTRLLLREAPTAWRARV
DELLLSAVARSLGQVLRVGRVRVTLEAHGRDVPLTGVDVSRTVGWFTAAYPVALDVAGRG
SEGDLLRAVRDSVRTVSGRGASYGLLRHLCADDVSRDLGSQPAPPVAFNYLGQFDGLAAG
LTLLEPASGSTGLSKAPGALRTEVLSVGARVLKERLRLEWTYSEHLHQRATIEALAGASL
ESVRALVSLRTTPDALRYTPADFPLAKLSADVLERILPPGEAVEDVYPLSPLQEGLLFHG
ILEPESGAYFEQVSCSFHAPLNAQAFHRAWQEAVATEPVLRTAFRWEGLERPRQVVLARA
ELPWRELDWRGLSPEEQEARLVQLRAEDRARGLDLTHAPLMRMSLIRTDARVHHLVWSFH
HLLMDGWSVGLLLRRIFSLYEAFGQGRALPRSQGATFRDYIAWLQHQDLGRAERYWRDAL
AGFTQPTPLPEDRGAARANNSRMLRQLSLSGAVTSALQEFARQQQLTLNTLVQAAWGLML
GRFAGLEDVVFGATVSGRPPEIEGVESTVGLLINSLPVRVRMSGDAVLGPWLQAFQQRQA
EQRQFEFSPLVEVQGWSGLSRGESLFEALLVFENYPLDSAVWEWARDLEVRGFAVSEWTN
YPLTCVVVPGRELELKLVHDVGRFEPESADAMLRHVGMLLESFVSHAEARLDALPLLSAP
ERQQVLAWGQPRAPAFDREPNVHQCFEAWAARTPDAVAVKGEQASLTYGELNRRANQLAH
HLRKQGVGPDVRVGLCVERSLEMLVGLLAILKAGAAYVPVDAKLPVERITWMLQAAGVRV
LVTQAALADELRPVAEVQVLLDADATVIARESETALGVTVPADALAYVMFTSGSTGRPKG
VSVPHRGITRLVRGADFIHFGPEEVFLQLAPIAFDASTLELWGALLNGATLVLAPPKALS
LEETGALLRREGITTLWLTAALFEQMVLHQGDALARVKQVLAGGDVLPVERVREHLRRMA
PGAVLVNGYGPTENTTFSTTYTLRAGDTVERSVPIGRPLTNSSAWVLNAGLRPVPPGMPG
TLYVGGDGLAWGYLQRADLTAERFIPHPFSSEPGARLYDTGDRVRWLRDGTLEFLGRTDF
QVKLRGFRVELGEIEAALRAHPAVRDAVVVVRTVAGDARLVGYVTARDGAHVDPWELRRM
LRDRLPDYMVPQALVPLDAFPLTAHGKLAREALPLPETVGTEESASADGAPRTPTEQLLA
DIWASVLGVARVGRDDDFFELGGHSLLATRVVSRLHAVFPLKVPLRELFEHPTVASLGQW
LDAALGAKSGSEAIARISSRARGEGEPLPLSFAQQRLWFLDQLTPGSAAYNIQAALRLKG
PLEVNALEQAFTHVVQRHEALRTTFGSVEGRPFQRIASDTSFALRRVDVSGIRDRARETA
RVATEEAQRPFDLEAGPLMRALLVKEGEGEHVLVLVMHHIVSDGWSMGVMVREVGRAYEA
KVKGTTAQEEPLEVQYADWAAWQREWLEGGALEEQLGWWRQRLAGAPAALELPTDKPRPV
VPSSAGASLDVHLPRSLAGSVKALAKQEGVTPFMVLLAAWQVVLARHAGQDDVSVGTPIA
GRQRVETEGLIGFFVNTLVLRTRVESGASFRELLAQVRETTLGAYAHQDVPFEKLVEALQ
PARDLARHPLFQVLFTLQNTPVTPWAVPGLSAAPYALARQASKFDLALSLTEQEDGFAGS
VEYSTDLYEERTVRRWMEGFERMVRALVEKPEQRVGDVEWMGAEERRRVVEEWNRTGKTY
GPKDECGHEAFEAVVDARPEAEAVRTEAGGVSYAEVEAKANQLAHHLKGQGVSPEVRVGL
LVERSVEWVVGMLAVLKAGGAFVPVDVTLPAMRVGELLEESGVALVLTSQRFAALVPNPH
TPVVLMDADAVQLAKHPTARPTKNMSPESMAYVLFTSGSTGKPKGVMVRHGGLANMAHAV
AEAHGVKPEDRVLQYASPGFDASVAEVFSTLAAGASLCLAPREALMPGGALEATVKSLGA
TVVTLTPSVLGQVQDGGLEGIRTLISAGEAVPAALVRKWSEGRRMLNGYGPTEVTVCASV
ATSLSPERVTVGKPLGNVRLYVLDEAQRPVGVGVVGELYVGGAGLARGYLGQPALTAERF
LPDGFSGEAGSRLYRTGDLVRWGEDGDVEYVGRRDGQVKVRGMRLEVGEVEGVLATHPAV
KQAAVVAKKDATGTKLWAYVVGDVETAALREWLRERVPEHMVPTAYGTLEALPLTSSGKV
DRAKLPALSADAMRTRAFVPPTTELERNLTALWQEVLGVERVGLEDRFFDLGGNSLLLVQ
LHSRMRGLLKVEVPLAELFQFSNIAALVARVQERSEQMDAPNEAAVEEEFAQRRARAGQR
RKARQQVEVSTQEDADE
NT seq 16254 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggcctctccccgaccgtcatccttttcggttttcgctcagcaccctccattc
cagtccctggtggagctgctccggcaccggggcgctgacgcggctcacgcgtctcgatac
acgttcctgggagagacgggagagctcgaggcctcctggacccacgcggaactggacctg
tacgcgcggcgcatcgcgggggcgctggcgggcgtggagcctggcgcgcgggcggtgctg
ctgtatccgccggggctcgactacatcgcgggcttcttcggctgtctctacgcggggctg
gtggcggtgccggcgtatccgccggatccgtcgcgcctggagcgcacgctgccccggttg
cgcgccatcatcgaggactcgcgcgcgacggtggtgctgaccacgtccttcatcctgtcg
atgaaggagttcctcacggatcaggcgccggagctgaacgggctgcactgggccgccacg
gatgcgctggagcccggagccgaggacggctggcgtccgcccgtggcgcgtccggacacg
ctggcgttcctgcaatacacgtcaggctccacggggatgcccaagggcgtgatgctcacg
cacggcaacctgctgcacaacctggacgccatccaccgcagcttccgggcgagcgccgac
agcgtgggcgtcatctggctgccgccgtaccacgacatggggctcatcggcggcatcctg
gagccgctgaacggtgggttcccggtgacgttgatgtcgccgctcacgttcctgcgccgc
ccgctcgtctggctggaggccatctcccagtacaagggcaccatcagcggcggtcccaac
ttcgcgttcgacctctgcgcgcggcgcatctccgaggaggatcgggcccggttggacctg
tcctcgtgggaggtggccttctgtggcgcggagcccatccgcacggagacgctggagcgc
ttcaaccgcacgttcgggccccagggcttccgggctccgtcgctctatccttgctacggc
ctggcggaaggcacgctgatcgccactggcgtgacgcagggcgcgggcgcctcggcgctc
acgctggaggcggaggcgctggctcggtcgcgggcggtgcgcgtggagccgggcaccccg
ggctcgcgtgagctggtggggtgtggccggtcgatggcggatcagtccatgctcatcgtc
gacccggaggcgcgcacgcctcgcgccgacggcgaggtgggcgaaatctggctgcgcggc
cccagcatcgcgcagggctactggcagcggccggagcagacggaggaggccttccaggcg
cgcctcgcgggcacgggcgagggccccttcctgcgcacgggcgacctgggcttcgtcgtg
gacggcgagctgtacgtcaccgggcggcgcaaggacctcatcatcctgcgtggccgcaac
cactacccgcaggacctggagctcacggcggagcgcgcgcacccggccatccgtccgggc
tccggcgcggcgttcagcgtcgacgtcgcgggcgaggagcggttggtccaggtccatgag
gtcagcctgcgcgacggcgtggacctgggcccggtgctggcggcggtgcgccaggcgctg
agcgaggagcatgagctccagccccacgcgttgctcctcgtggagccggggagcgtcccg
aagacgtccagcgggaagatccagcgtcgcgcctgccgcgagagcttcctcgacggttcg
ctgcgcgtcgtcacccagtggaaggagggcggcgcgctcgaggcgcacgcggacgttcag
gaggacgccgcgccgggggacaccgccgagtcgatgggcgcctggctgcggagccgcgtg
gctgcgcggctgcgcgtccggcccgacgaggtgtcctccaccgagcccatcacccggctg
ggtttggattcgctcgcggcggtggagctgagccacgacatcgagaagggcctgggcatc
atcctgcccatggaggcgctgctgcaggggcccaccatcgcggagctggccgggcgtgtg
ctcgcgcaccgcgcgggttccaaccgcctggcgccgccggccctgaagccgaggacccgc
gaggagctgcccgcgctgtccttcgcgcagcagcggctgtggttcctggatgcgctcgtc
cgtggcagccccgcgtatcacatccccgtcgcggtccggctggtggggccgctcgacgtg
ccggcgcttcagcatgcgctggatgtgctggtgcggcgccatgaaaccctgcgcaccacc
ttcgtctcccgcgacggcgttccggcgcagcgcatccacccggacctgcccgtgacgctg
gagccggtggacgtgagtgggcgggaggatcgcgcgcaggagacggcgcgtctggcgcga
gtggaggcggcgcgctccttcgatctggagacgggcccgctgatgcgggcgctgctggtg
aaggagggggaaggggagcacgtgctggtggtggtgatgcaccacatcgtgtccgacggc
tggtcgatgggcgtgatggtgcgggaggtggggaaggcctacgaggcgaaggtgaagggg
gaggagtggcgggaggcagcgctggacgtgcagtacgcggactgggcggcgtggcagcgg
gagtggctggagggtggggccctggaggagcagctggggtggtggaagcagcagttggcc
ggcgcacccgcggcgctggagctgcccaccgacaagccccggccggtgaaccccacgttc
cgcgcccacaacgtcgacgccagcctgtcgcggtccctgtctgaggcggtgaaggggctg
gcgaggcaggagggcgtgacgccgttcatggtgctgctggcggcgtggcagctggtgctg
gcgaagcacgcggggcaggacgatgtgagcgtgggaacgcccatcgcggggcggcagcgg
gcggagacggaggggctcatcggcttcttcgtgaacacgctggtgctgcgcacgcgggtg
gagagcggagcgagcttccgggagctgctggcgcaggtgcgggagacgacgctgggagcg
tacgcgcaccaggacgtgccgttcgagaagctggtggaggcgttgcagcccgcgcgcgac
ctggcgcggcacccgctgttccaggtgatgctcgccttccagcaggactcgctgcctgag
ctgaagctgccggggctggccttgagggccgtgccgttggactccggcgcggtgaagttc
gacctgtcgctgaacctgtcggagaccgcggagggcttcaccggcacgctgatcagctcc
gcggacctcttccaccgcgcgagcaccgagcggatggtgcggcactggcacacgctgctg
gaggccgcgacggtccaacccggcctgcgggtggacgcgctgccgctcctggatgaggaa
gcgcggcgctcggtgctcgaggcctggccggaggagcggctggaggcgggggacgacacg
tgtctgcatgcgctcttcgaggcgcaggcggcgcgcgttccggacgacgtggcggtgatg
ggtggcggccagtcactgacgtaccgcgcgctggatgcgggcgcgaaccagctcgccggt
gcgctgcgcgcgatgggcgtgggccccgatgctcgcgtgggcctctgcgtggaccggcgt
gccgacgcgatgcgtggcctgctgggcatcctcaaggcgggcggcgcctacgttccgttg
gaccccgcgaaccccggggagcggttgcgcctgatgctcgacgaggcgcgcgtggacgtg
gtggtgacaatccgcgagcttgcctcgcgcttcgacggccaccctggacggctcgtgctg
ctggatgacggggaggcgccgttcgcgtcgttcccctcggatgcgccgcccgttcgcggc
gccgtgccgtcgaacctggcctacgtcatcttcacctcgggctccaccggccggccccgg
agcgtgggcatcgagcaccggcacatcgtgcgctatgtgcgggggctcgtgcggcgcctg
gacctggcgcagggcgcgtcgttcgcgtctgtctccacgctggcggcggacctggggcac
accgcgctcttccccacgctggcccagggcggcaccctgcatctggtggacacggagacc
gcgtccgacccggcggcgctgggcgcgtacttcgcccggcatggcgtggagggattgaag
atcgtcccgtcgcacctgcgggcgttgctggcgtcggagtcgccggagcggctgttgccg
cgccgctggctggtgctcggtggtgagtcgtccgactgggcactcgtggatcaggtgcgt
tcgctcgtgccgggctgcgcggtgttcaaccactacggccccacggagaccaccgtgggc
gtgctcacgctgccggcctccgcgcaggcgcgcgaggatcgtccggtcgtcgtgccgctg
ggccggcccctgccggaggtgcgcgcgtacgtcctggacgcgggccttcgcccggtgccc
ccgggcgtcgcgggcgggctctacatcgcgggcggcacggtgggccggggctacctgggc
cggccggagctgaccgccgaccgcttcatcccgtcgccgttcgcgaagacgcccggcgag
cgcatgtaccgcacgggcgaccgggcgcggctcgggcccgacggcgccatcgtgttcctg
gggcgcgaggacgatcagctcaaggtgcgcggcttccgcgtggagccgggtgaagtggag
gcggtgctcaagcagcacccggccatcgccgaggcggtggtggtcgcccgcgatgcgggc
gggggggagcggcggctcgtggcgtacgccgtgccggcgaccggcggccagctgggcccg
gacctcctcaagacgttcctcgaagagcggttgccgtcgtacctggtgccgtccgcggtg
gtcgtgctggagaccctgccgctcaccgccaacggcaaggtggaacgccgcgcgttgccg
gagcctgccgggttcgcgcgcgcggagccctccgcgccgggcaccccctacgaggcgctg
ctcgcctccgtctgggcgcaggtgctgggcgtgagtgacgtgggccctgacgatgacttc
ttcgagcgcggcggccactcgctgctggccacgcgcgcggtgtcccgcatccgttcggtc
ttccaggtggacctgccgctgcgcgcgttgttcgagacgccgaagctgggcgcgctcgcc
agacggctggaggccctgtcacgcacgggcgcggatgccgtgcggcctcccgtcgtgccg
gtgccgcgggaccggccgctgccgctgtcgttcgcgcagcagcgcctgtggttcctcgac
cggatggagccgggcaacgcgctctacaacgtgcccgccatgctgtggctggagggggcg
ctcgatgccgaggccctggagcgctcgctggcggagatcctcctgcgccacgaggtgctg
cgcacgaccttccacgagacaccggacggagcggtccagcgcgtcgcagcggcacccgcg
cgcgccctgacgcacgtcgacctgcgcgacgtagccccggatgcgctcgaggcgcgggcg
cgtgaatgggcgcgcgaggacgcgtcgcggcccttcgacctcgtcacgggcccgccggtg
cgcatggcgttgctgacgctgcgggatgaccggcacgtgctggtgctggtgatgcaccac
atcgtcgcggacggctggtcgctgggcgtgctcgtccgggagctgggggcgttgtacggc
gccttcacgcgcggcaccgcgtccggcctgccggcgctcgccgtgcagtacgcggaccac
gccgtgtggcagcgcggctggctccagggcgccgtgcgggatgcgcagctctcctggtgg
cgcgagcagctccaggacgcgccccgggtgctggaccttcccctggcccgccaccgcccg
aaggtgcgcacatcacagggggcccaggccatgcacgtgctgccgcgcgccaccgcggag
tccgtgcggcagctcgcgctgcgcgaaggtgccacgccgttcatggtgatgatggcggcc
ttccaggcgctgctgcatcgctacaccggccgcaccgacctgctggtgggcacggacatc
gccaaccggcaccacgcggagaccgaggccctggtgggcttcttcgtcaaccaggtggtg
ttgcgcacccgccccacgccagtgctgccgttccgcgcgctgctgggccaggtgcgcgag
gccgcgctgggcgcctacgcccaccaggacctgcccttcgaggagctggtgcgcgacctg
aacccggagcgcagcctgagcgcgtcgcccctgttccaggtcaagctcatcttccagaac
gcgcgcgacgcggagctggcgctgcccggtctgtccctgcgcgtggagtccatcgacccg
ggcgcgtcgaagttcgacctcaccgtggccttcagcgacaccgcggagggcctgtccggc
ctctgggagtacagcaccgacctcttcgacgcggtgacggtggcgcgcatgcaggaacac
ctgcgcacgctcctggagggcgccctgtcgcggcccgacggcgcgctggagacgctgccg
ctgctcacggaggcggagcgggcccacgtcctgggaacctggaacgccgccacgcttccc
atcggcgagcccctgcgggtccaccgccgcttcgaggccgcggtcgaggccttcggcgac
aggcccgcgctccgcttcgaggggcaggagctgagctaccgggagctggaggctcggtcc
aacgcgctcgcgcgccacctgcgcgcgcagggcgtggggctggagacgcgcgtgggcatc
tgcctggagcgttcgcccgagctggtggtcgccatgctggcgacgctcaaggccggcggc
gccttcgtcccgctggatccggcgtacccgagcgcccgcctgaccttcatgctgcaggac
tccgcggtgcccgtcgtggtgacccgctcggagctcgcggacgagctgcccgcgacgggc
gcccatctggtgtgcctggacgaggacgccgcgcggctggagcggcttcccggaacgccg
ctggaggacgcgggcgctcccggacatctggcgtacgtcatctacacgtcgggctccacc
ggcaggcccaaggggacgctgctgacgcacgggggcctctgcaacacggccgtggcggtg
ggccgcgcgcacggcgtccatccggacagccgcgtgctgcagttcgcctccagcagcttc
gacgcgggcgtgtgcgaggtcttctccacgctcctgtccggcgcgtgcctggtgctcgcg
ccgaaggacgcgctcttgccggggcccgcgctggagcggacgctgacggagcaggccatc
accaccgtgacgctgacgccgtcggtgctcgcgcagcagtcgccggaggggctcacccgg
ctggagacgatcatctccgcgggcgaggcctgtccgccggaggtggtgcggcgctggtcg
ccgggccgccgcttcatcaacgcgtacggccccacggagatcaccgtgtgcgccacgctg
acggatcaaccgctgtcggcggaccgagtgaccattggcgggccgctggccaacgtgcgc
gtgtacgtgctgtccccggcgcttctgccggtgccgccgggcgtccctggcgagctgtac
gtgggcggggcgggcgtgggccgtggctacctgggccacccgtcgctcaccgccgagcgc
ttcatccccgatcccttctccccggagcccggcgcgcggatgtaccgcacgggcgaccgg
gtgcggtggttggaggtcggagccctggagttcctgggccgctcggactcgcaggtgaag
gtgcgcggcttccgcatcgagctggaagaagtagaggccgtgctgggcgcgcagcccggt
gtccaggccgcggcggcgacggtgcgtgaagaggcctccggcgtgcgccggctggtgggc
tacgtggtgcccttcgagggcgcggcgcccgacgaagcgtcgctgcgcgaagggctgcgg
cggcgtctgccggagcacatggtccctgcggccttcgtggtgctggacgcgctgccgctg
tcgcccaacggcaaggtcgaccggaatgcgctgccggcgctcggcggccgtccggcgcgc
gaggagacacccttcgtggagccctccacgcccgcggagctgctgctcgcgtcgctctgg
cagcagatcctccgcgtggagcgggtgggggcggacgacaacttcttcgagctgggtggt
gactccatcatcagcctccaggtcgtcgcgcaggcgcggcgggccggactggcgatcacg
cccaagcagctcttcgagcaccagaagctgcgggatctggctgcggcggccacgctggac
gccaccccggccgtcgccgacgcagggccggtgagcgggacggtgccgctcactcccatc
cagcgctggttcctggagcaggggtcgcccgcgccggagcactacaaccaggcggtgctc
ctgggggcccgtgagtcgctggacgcggggctcgtggaagcggcgctgcgggcgctctgg
cggcaccacgacgcgctccgcctgcgcttcacccgcgcatgcgacggatggtcacagcag
tacggctcgcccgacgaagcggtggacttccttgtccgcgaggacctgtctggcctgccc
gaggaggcgcgcgaggcgcggctggagcaggtggccacccgcgtccagggcagcctcgac
ctgggctcggggccgctgatgcgggcggtgctcttcacgatgggcacggggcagcccgcc
cggctgctctgggtcatccaccatctcgtggtggacggcgtgtcctggcgcacgctgctg
gaggacttcgagtccgcctacctggcgctgcgcaacggacaggcgcccgcgctgcctccg
cgcaccacgtccttcaagacgtgggcggagcggttggaggcctacgccgcgacggacgcg
gtggccgccgaagcggatgtctggcgcgctcaggcgcacgtgcccgtggagcccctcccg
ctggacggtcccggtggcgagaacaccgtggcctccgcgcggacggtatccgtggagctg
gacgcggagacgacccggttgctgctgcgcgaagcgcccacggcatggcgcgcgcgcgtg
gacgaactgctgctgtccgcggtcgcccggtcgctggggcaggtgctgcgcgtgggccgc
gtgcgcgtcacgctggaggcacacggccgcgacgtgccgctcaccggcgtggacgtgtcg
cgcaccgtgggctggttcaccgcggcgtacccggtggcgttggacgtcgcgggccggggc
tcggagggagacctgctgcgggccgtgcgtgactcggtgcggacggtgtccggccggggc
gcgtcctacgggctgctgcgccacctgtgcgcggatgacgtctcgcgcgacctgggatcg
cagcccgcgccccccgtggccttcaactacctgggccagttcgacggcctggccgcgggg
ctgacgctcctggagcccgcgagcgggagcacgggcctgtcgaaggcgcccggcgcgctc
cgtacggaagtgctgtcagtgggcgcacgcgtgttgaaggaacgcctgcgcctggagtgg
acctacagcgagcacctgcaccaacgcgccaccattgaagcgctggccggcgcgagcctg
gagtccgtgcgggcgctggtgtccctgcgcacgacgccggacgccctgcgctacacgccc
gcggacttcccgctggcgaagctgtccgcggacgtcctggagcgcatcctgccgcccggc
gaggcggtggaggacgtctatccgctgtccccgttgcaggagggcctgctcttccacggc
atcctggagccggagtcgggggcgtacttcgaacaggtgagctgttccttccacgcgccc
ctcaacgcgcaggccttccaccgcgcgtggcaggaggccgtggcgacggagcccgtgctg
cgcaccgcgttccggtgggaaggactggagcggccccgccaggtggtgctcgcccgggcc
gagctgccctggcgtgagctggactggcgtggcctgtcccccgaggagcaggaggcgcgg
ctcgtgcaactccgcgcggaggaccgcgcccgagggctggacctcacgcatgcgccgctg
atgcgcatgtccctcatccgcacggacgcgcgggtgcaccacctggtgtggagcttccac
cacctgctgatggacggctggagcgtgggcctgctgctgcggcgcatcttctccctctac
gaggccttcggtcagggccgcgcgctgccccggagccagggcgcgaccttccgcgactac
atcgcgtggttgcagcaccaggacctgggccgtgcggagcgttactggcgcgacgcactg
gcgggcttcacccagcccacgccgctgccggaggaccggggcgcggcgcgcgcgaacaac
tcgcggatgctgcggcagctgtcgctgtcgggcgccgtgacgtccgcgctccaggagttc
gcgcgccagcagcagctcaccctcaacacgctggtgcaggccgcgtggggcctgatgctc
ggtcgcttcgcggggctggaggacgtcgtcttcggcgcgacggtgtccggccgtccgccg
gaaatcgaaggcgtcgagtccacggtgggcctgttgatcaactcgctgccggtccgcgtg
cggatgtcgggcgacgcggtgctcgggccctggctccaggcgttccagcagcggcaggcg
gagcagcgtcagtttgagttcagcccgctggtggaggtgcaggggtggagcgggctgtcg
cgcggcgaatcgctcttcgaagcgctgctcgtgttcgagaactacccgctggactcggcg
gtgtgggagtgggctagggatctggaggtccgtggcttcgcggtgagcgagtggacgaac
tatccgctcacctgcgtcgtcgtcccgggccgcgagctggagctgaagctggtgcacgac
gtgggccgcttcgagcccgagtccgccgacgcgatgctgcgccacgtggggatgctgctg
gagtccttcgtgtcgcacgcggaggcgcggctggatgcgctgcccctgctgtccgctccg
gagcgtcagcaggtgctcgcctggggccagcccagggcaccggcctttgaccgcgaaccg
aacgtgcaccagtgcttcgaggcctgggccgcgaggacgccggacgcggtggcggtgaag
ggcgagcaggcgtcgctgacgtatggcgagctgaaccggcgggccaaccagctcgcgcac
cacctgcgcaagcagggcgtggggcccgacgtgcgcgtgggcctgtgcgtggagcgctcg
ctggagatgctggtgggcctgctcgccatcctcaaggctggtgcggcctacgtgccggtc
gacgcgaagctccccgtggagcgcatcacctggatgctccaggcggccggcgtccgcgtg
ctcgtcacgcaggcggcactggcggatgagctgcgcccggtcgcggaagtccaggtcctg
ctggacgcggacgcgaccgtcatcgcccgggagtccgagacggcattgggcgtgacggtg
cccgccgacgcgctggcctacgtgatgttcacgtcgggcagcacgggccgtcccaagggc
gtgagcgtcccacaccggggcatcacccgcctggtgcgcggcgcggacttcatccacttc
ggcccggaggaagtgttcctccagctggcgcccatcgcgttcgacgcatccacgctggag
ctctggggcgcgctgctgaatggcgcgacgctggtcctggcgccgcccaaggccctgtcg
ctggaggagacgggcgcgctgctgcgccgcgagggcatcaccacgctgtggctcaccgcg
gccctcttcgagcagatggtcctgcatcagggcgatgccctggcgcgagtgaagcaggtg
ctcgcgggcggcgacgtgctgcccgtggagcgcgtgcgtgaacacctgcggcggatggcg
ccgggcgcggtgctggtcaacggctatggccccacggagaacaccacgttctccaccacg
tacacgctgcgcgctggggacaccgtggagcgctcggtgcccatcggccggccgctgacg
aattcctcggcgtgggtgctgaacgccgggctgcggcccgtgccaccgggcatgcccgga
acgctgtatgtcggtggagacggcctggcctggggctacctccagcgcgcggacctcacg
gccgaacgcttcatcccccatcccttctcctccgagcccggcgcgcgcctctacgacacg
ggcgaccgcgtgcgctggctgcgcgacggcacgttggagttcctgggccgcaccgacttc
caggtgaagctgcgcggcttccgcgtggagctcggtgaaatcgaggccgcgctgcgcgcc
cacccggccgtgcgcgacgcggtggtggtggtgcggacggtggcgggtgacgcgaggctc
gtgggctacgtgacggcccgcgacggcgcgcacgtggacccctgggagctgcgccgcatg
ctgcgcgaccggctgccggactacatggtgccgcaggcgctggtgcccctggacgcgttc
cccctgacggcccacggcaagctggcgcgtgaagccctgccgctgccggagacggtgggc
acggaggaatccgcgtccgcggacggggcgccgaggacgcccaccgagcagctgctggcg
gacatctgggcgtcggtcctcggcgtggcgcgggtcggtcgcgacgacgacttcttcgag
ctgggaggccactcgctgctggcgacgcgggtggtgtcgcggctgcacgcggtgttcccc
ctgaaggtgccgctgcgcgagctcttcgaacatccgacggtggcttcgctggggcagtgg
ctggatgcggcgctcggagcgaagagcgggtcggaggccatcgctcggatttcgtcgagg
gcccggggtgaaggggagccgttgccgctgtccttcgcacagcagcggctgtggttcctg
gatcagctcacgcccggaagcgctgcgtacaacatccaggccgcgctgcggctgaagggg
ccgctggaagtgaacgcgctggagcaggcgttcacgcacgtcgtccagcggcacgaagcg
cttcgcacgaccttcggctcggtggaaggacgcccgttccagcgcatcgcctccgacacg
tccttcgccctgcggcgggtggacgtgagcgggatcagggaccgcgcacgggagacggca
cgggtggcgaccgaggaggcgcagcggccgttcgacctggaggcagggcccctgatgcgg
gccctgctggtgaaggagggtgagggcgagcacgtgctggtgctggtgatgcaccacatc
gtgtccgacggctggtcgatgggcgtgatggtgcgggaggtgggccgggcgtacgaggcg
aaggtgaagggcaccacggcgcaggaggaaccgctggaggtgcagtacgcggactgggcg
gcatggcagcgcgagtggctggagggcggggcgctggaagagcagttggggtggtggcgg
cagcggctcgcgggagcgcccgcggcgctggagttgcccaccgacaagccccggcccgtc
gtgccctcgtccgcgggcgcgagcctcgatgtgcacctgccgcggtcgctggcggggtcg
gtgaaggcgctggcgaagcaggagggcgtgacgccgttcatggtgctgctggcggcgtgg
caggtggtgctggccaggcacgcgggtcaggacgacgtgagcgtgggaacgcccatcgcg
gggcggcagcgtgtggagacggaggggctcatcggcttcttcgtgaacacgctggtgctg
cgcacgcgggtggagagcggggcgagcttccgggagctgctggcgcaggtgcgggagacg
acgctgggagcgtacgcgcaccaggacgtgccgttcgagaagctggtggaggcgttgcag
cccgcgcgcgacctggcgcggcacccgctgttccaggtcctcttcacgctgcagaacacg
ccggtgacaccgtgggcggtgccagggttgtcggcggcgccgtacgcgctggcgcgtcag
gcctcgaagttcgacctcgcgctgtccctcacggagcaggaggacggcttcgcgggctcg
gtggagtacagcacggacctgtacgaggagcggacggtccgccggtggatggaaggcttc
gagcgcatggtgcgagcgctggtggagaagccggagcagcgggtcggggacgtggagtgg
atgggggcggaggagcggcggcgggtggtggaggagtggaaccgcacggggaagacgtac
ggcccgaaggatgagtgcggacacgaagccttcgaagcggtggtggacgcgcggccggaa
gcggaggcggtgcggacggaagccggaggggtgagctacgcggaggtagaggccaaggcg
aaccagttggcgcatcacctcaagggccagggagtgagcccggaggtgagggtgggcctg
ctggtggagcgaagtgtggagtgggtggtggggatgctggcggtgctgaaggcgggagga
gccttcgtgccggtggacgtcacgctgccggcgatgcgagtgggcgagctgctcgaagag
tccggtgtcgccctggtgctgacgtctcagcgcttcgcggcgctcgttcccaatccacac
acccctgtggtcctcatggacgcggatgctgtgcagttggcgaagcaccccacggcccgt
cccacgaagaacatgtcgccggagagcatggcgtacgtgctcttcacgtcaggaagcacg
ggcaagcccaagggcgtgatggtgcgtcacggcggcctggcgaacatggcgcacgcagtg
gccgaagcgcacggcgtgaagcccgaggaccgggtgctgcagtacgcctcaccgggcttc
gacgcctcggtggcggaggtcttctcgacgctggcagccggagcgagcctgtgtctggcg
ccgcgagaagcgctgatgcccggaggcgcactggaagcgacggtgaagagcctgggcgcg
acggtggtgacgctgacgccttcggtgctgggccaggtgcaggacggagggctggaaggc
atccgcacgctcatctccgcgggtgaggccgtgcccgctgcactggtgcgcaagtggagc
gaaggccggcggatgctcaacggctatggcccgacggaggtgacggtctgcgccagcgtg
gcgacgtcgctttcaccggagcgcgtaacggtgggcaagccgctggggaacgtgcggctg
tacgtgctggacgaagcgcagcgtcccgtgggcgtgggcgtggtgggcgagctgtacgtg
ggaggcgcgggcctcgcacgtggctacctgggccagcccgcgctgacggcggagcgcttc
ctgccggacggcttcagcggtgaagccggcagccgcctctaccgcacgggcgacctggtg
cgctggggcgaggacggagacgtggaatacgtaggccgtcgcgacgggcaggtgaaggtg
cgcggcatgcggctggaggtgggcgaagtcgaaggcgtgctggcaacgcacccggcggtg
aagcaggcggcggtggtggcgaagaaggacgccacgggcacgaagctgtgggcctacgtg
gtgggcgacgtggagacggcggccctgcgcgagtggctgcgcgagcgcgtaccggagcac
atggtgcccacggcctatgggacgctcgaagccctgccgctgacgtccagcgggaaggtg
gaccgcgcgaagctgcccgcgctgtcggcggatgccatgcgcacgcgagccttcgtgccg
ccgacgacggagctggagcgcaacctcacggccctctggcaggaggtgctcggcgtcgag
cgcgtcggcctggaggatcggttcttcgacctggggggcaactcgctgttgctcgtgcag
ttgcacagccgcatgcgcgggttgctcaaggtcgaagtgccgctcgcggagttgttccag
ttctccaacatcgcggcgctcgtcgcgcgggtccaggaacgctcggagcagatggacgcg
ccgaacgaagccgccgtcgaggaggagttcgcgcaacgcagggcgcgcgccggccaacgc
cggaaggcccggcagcaggtcgaagtgtcgacgcaggaggatgccgatgagtga

DBGET integrated database retrieval system