KEGG   Corallococcus coralloides: COCOR_04769Help
Entry
COCOR_04769       CDS       T01780                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00620  Pyruvate metabolism
ccx00680  Methane metabolism
ccx01100  Metabolic pathways
ccx01120  Microbial metabolism in diverse environments
ccx01200  Carbon metabolism
Module
ccx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    COCOR_04769 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    COCOR_04769 (ppc)
Enzymes [BR:ccx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     COCOR_04769 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AFE09951
UniProt: H8MKT9
LinkDB All DBs
Position
complement(6026469..6029087)
Genome map
AA seq 872 aa AA seqDB search
MGRLLGEVLVEQEGQALFDKEEEVRHLAIQRRRGPVAGRRAAAAELAAVLRRLPSEQVEP
VLRAFSVYFQLVNLAEQHHRIRRARAHASPTATRPQKGSLESTLLALKAAGVSADKVRET
LGTLKVTLTFTAHPTQAVRRTLLEKLYRLAMLLEERDRCTLTPRESAANLTAMREEITAL
WQTDELRRERPTVGDEVKNVHWYVEEMLAEPVARLPEALDWAFERAYGEPLGALDTPVRV
HSWVGGDMDGNPLVTPEVFADTLRAHRARGLRLLLRDVERLGGMLSQSERHARPTQELER
SLEEDAKALPDVAKQQGPRTLGEPWRRKLRFMEERLTLALEHVLARRQGRESTLPAGAYR
SPEALGDDLAVLERSLFAARAEHAGLREVRRMSERVRALGLGLGELEVRAPAEDAVSAAA
SFSGGPAPTEGGQRLLEVLAKLREGQDEGGESVCRTLILSMASTADDVLAAFQCLKHAGL
WDKERQCATVDVAPLFEQLGALDGGPDVLRQLFAHPEYRQHLKGRGVQEVMVGYSDSGKE
VGLLAASAALYRAQVALTQVADENDVPLRLFHGRGETVARGGGPAQTAILALPPGTVAGA
YKATEQGEAMDHKYARPELTQRTLELVVGGVLLHTLDAQPRPSPEDESAFRAAFDALAES
GRKAYRALVWEDPGFVEFFMKGTPVEEISALPIGSRPSKRKAGGLDTLRAIPWSFAWTQT
RAILPAWYGVGSALEESAATPEGAALLQRMYKEWPFFRAVIDNVTMVLAKTDMAIAARYA
KLAPASTRPLWLRIQQEHSRTRRAVKTITGEAKLLDNNPQLQRSIALRNPYVDPMSFLQV
ELLKRKRDGDAECDRPLLLALNGIAAGMRNTG
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
ttgggccggctgttgggtgaggtgttggtggaacaggaggggcaggccctgttcgacaag
gaggaggaggtccgccacctggccatccagcgccggcggggcccggtggccggacgacgc
gccgcggcagcggagctggcggcggtgttgcggcggctgccgtcggaacaggtggagccg
gtgctgcgcgccttctccgtctacttccagttggtcaaccttgcggagcagcaccaccgc
atccgccgcgcgcgggcccacgcgagccccaccgccacccggccccagaaggggtcgctg
gagtccacgctgctggcgctgaaggccgcgggcgtcagcgccgacaaggtgcgtgaaacg
ctggggacgctgaaggtgacgctgacgttcaccgcgcacccgacccaggcggtgcgccgc
acgctgctggagaagctctaccggctggccatgctgctggaagagcgcgaccggtgcacg
ctcaccccgcgcgagtccgccgcgaacctcaccgccatgcgcgaggagatcaccgcgctg
tggcagacggacgaattgcgccgcgagcgccccaccgtgggcgacgaggtgaagaacgtc
cactggtacgtggaggagatgctggcggagccggtggcccggctgccggaggcgctggac
tgggccttcgagcgcgcctacggcgagcccctgggcgcgctggacacgcccgtgcgcgtg
cactcgtgggtgggcggcgacatggacggcaacccgctggtgacgccagaggtgttcgcg
gacacgctgcgcgcgcaccgcgcccggggcctgcggctgctcctgcgcgacgtggagcgg
ctgggcgggatgctgtcccagtcggagcggcacgcgcgccccacgcaggaattggagcgc
tcgctggaggaggacgcgaaggcgctgccggacgtggcgaagcagcagggcccgcgcacg
ctgggcgagccgtggcgccgcaagctgcgcttcatggaggagcggctgacgctggcgctg
gagcacgtgctcgcgcggcggcagggaagggagtccacgctgccggcaggggcctaccgg
tcaccggaggcgctgggggatgacctggcggtgctggagcggtcgctcttcgcggcgaga
gcggagcacgcgggcctgcgcgaggtgcgccgcatgtccgagcgcgtgcgcgcgctgggc
ctgggcctgggcgagctggaggtgcgggctcccgcggaggacgcggtgagcgcggcggcg
tccttcagcggcggaccggcccccaccgagggcggccagcggctgctggaggtgctggcg
aagctgcgcgagggccaggacgagggcggcgagtccgtgtgccgcacgctcatcctctcc
atggcctccaccgcggatgacgtgctggcggcgttccagtgcctgaagcacgcggggctc
tgggacaaggagcggcagtgcgccaccgtggacgtggcgccgctcttcgagcagctgggc
gcgctggacggcgggccggacgtgctgcgccagctcttcgcgcacccggagtaccgccag
cacctgaagggccgtggggtgcaggaggtgatggtgggctacagcgactccggcaaggag
gtgggcctgctcgccgcgagcgccgcgctgtaccgcgcccaggtggcgctcacgcaggtg
gcggacgagaacgacgtgcccctgcgcctgttccacggccgcggggagacggtggcgcgc
ggcggcggccccgcccagacggccatcctcgcgctgccgccgggcacggtggccggcgcc
tacaaggccaccgaacagggcgaggcgatggaccacaagtacgcgcgcccggagctcacc
cagcgcacgctggagctggtggtgggcggcgtgctgctgcacacgctggacgcgcagccg
cgcccgtccccggaggacgagtccgccttccgcgccgccttcgacgcgctggcggagtcc
ggccgcaaggcgtaccgcgcgctcgtctgggaggacccgggcttcgtggagttcttcatg
aagggcacgcccgtggaggagatctccgcgctgcccatcggctcgcgccccagcaagcgc
aaggcgggcgggctggacacgctgcgcgccatcccgtggagcttcgcgtggacgcagacg
cgcgccatcctcccggcctggtacggcgtgggcagcgcgctggaggagtccgcggccacg
ccggagggcgcggcgctcctgcagcgcatgtacaaggaatggcccttcttccgcgcggtc
atcgacaacgtgaccatggtgctggccaagacggacatggccatcgcggcgcggtacgcg
aagctggcccccgcgtccacgcggcccctgtggctgcgcatccagcaggagcactcccgc
acgcgccgcgcggtgaagacgatcacgggggaggcgaagctgttggacaacaacccgcag
ctgcagcggagcatcgcgctgcgcaacccctacgtggaccccatgtccttcctccaggtg
gagctgctcaagcgcaagcgggacggggacgcggagtgcgaccggccgctcctcctggcg
ctcaacggcatcgctgcgggcatgcggaacaccggttag

DBGET integrated database retrieval system