KEGG   Corallococcus coralloides: COCOR_05735Help
Entry
COCOR_05735       CDS       T01780                                 

Gene name
lgrC3
Definition
(GenBank) Linear gramicidin synthase subunit C
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C UPF0236 Tox-HNH-HHH
Motif
Other DBs
NCBI-ProteinID: AFE09206
UniProt: H8MFK5
LinkDB All DBs
Position
7202781..7208228
Genome map
AA seq 1815 aa AA seqDB search
MPTGTTSGSSPVPDLAFSTLVELLRVRASTQGDRRGFTFLLDGETDEAHLTYAELDQKAR
AIAAALQARGAQGQRALLLYPPGLDYIAGFFGCLYAGVIAVPIYPPDPMRLARTLPRLLA
ISQDAQATIALTTDFIYGMGEMLFEQAPELRELHWIATDTLDAEVAEGWKDPGVATDTRV
FLQYTSGSTSSPKGVVLTHGNLLHNSKLIHSCFGHSAESQGVIWLPPYHDMGLIGGILQP
LYGGFPVTLFSPVDFLKRPMRWLEAISRYKATTSGGPNFAFDLCVRKSTPEERAKLDLSH
WDLAFNGAEPIMPDTLRRFAEAFGPQGFRSEAIYPCYGLAEGTLIASGGDKRELPVQRTV
DGGALKDNRVVAKEAASPGAQTLVGSGRNLTDQRLVIAHPETGAPLPAGQVGEIRVAGPS
IAQGYWGREEQTRTTFQQPLAGTGDPTPFLRTGDLGFLADGELFVTGRLKDLIIIRGRNH
YPQDIERTVESAHPAIRPGCTAAFSIEQDDEERLIVVTEVDRRAVERDGVDLDALAQGIR
QAVAAGHDLQAQGVVLLGPGAIPKTSSGKIQRFATRAEYVADTLEALHKSVLAAAPVPAP
EAVKTAAPEAAAAPAPVGPDTSMLQKMLAVVTDATARRAMVAVFLQEQAAQVLRLPTAQV
DVQKPLHAYGVDSLMAVDFKSAVDAGLGIDLPLSDVLQGVSLSKLAEVVVTLMSAPPSQQ
ASNAVAASSATGDAPLSGGQQALWFMHQLAPESAAYHVPVAVRVRAGLDANALKGAFEAL
VARHPALRTTFVMAATGPVQRVHAELPLDFTTTDAKGWSDAQVAEHLSAEARRPFDLEKG
PLLRVRLVSRSAEDHALLIAMHHIVTDFWSLAVMAEELDALYPALKLGKRPSLAQPARTY
ADYARWQSEMLTGARGQALEKYWREQLSGTLPVLDLPTDHPRPPAQTFNGRVHTTRLDAS
VASAVKTLARDHGATPNMVLQTAFQVLLHRYTGQQDFTLGVVSAGRGRAELAGITGYFVN
PLVVRTRPSPTLSFTDYLAQTRQTMLGALEHQDYPFSALVDRLQPVRDQSRSPLFQVMFV
YQRASKLDERGLTPFALDIPGAKSTVAGLPIESLVLSHGGAQFDLTLTMGEADGELVASF
EYNTDLFEAGTIERMAGHLATLLSGIAAQPGHALAGLPLLTQAEQQQLLETWKGPRVPLT
QADMLPALFAAQVARTPDNVAVLFKDAQLTYRELDARAGQLAAWLRGAGVKPGDIVGICL
ERSVETLVSVLAVMAAGAAYVPIDPAYPSERVAFILGDTQAPVLITQSWLQRTLPSGTSA
RTLFVDQPLDGALSSAPAATVAAGDLACLVYTSGSTGQPKGVMLEHGGLANLVRSFVESY
APGATDRMLPLTSVASASFVGEILPLLCTGGALVLPTEEEILDQEKLFQLITRHTVTIVS
TVPAVIAGLNARLEQLPPLKLVLSGGEALVASDVEKLLATVPVVNGYGLTETTVCSTYHR
MAVEDLQGHAWVPIGRPVINTDVYVLDAERNLLPVGVAGELYVGGLGVARGYWKRPELTT
ERFVANPFASDKGERLYRTGDRARWLPDGVLTFLSRADDQVKIRGFRIELGEVEAAVRRH
PAVKDAFLMAREDSPGDKRLVAYMVLGEPAPTHSDLNSFLAEGLPPYMLPSAYVPLAALP
LSPNGKVDAKALPAPEGARLASGVAYAQPQSAVERSVAAIWAAVLKVERVGLNDNFFELG
GNSLLIAQAHRRLKEELGADLALVDMFKFTTVSALAQHLANKGEDSGAASQKIKDEAERR
RAAQARRQQARGRGK
NT seq 5448 nt NT seq  +upstreamnt  +downstreamnt
atgcctactggaaccacgtccggttcttccccggtccctgaccttgcgttttccaccctg
gttgaattgcttcgcgttcgcgcgagcacccagggagaccgtcggggctttacgttccta
ttggacggggaaacggatgaagcgcacctgacgtacgcggagctggatcagaaggctcgc
gccatcgcggcggcgctccaggcgcgcggggcccagggccagcgggcgctgctgctgtat
ccgccggggctggactacatcgccgggttcttcggctgtctgtacgcgggcgtgatcgcg
gtccccatctatccgccggaccccatgcgcctggcgcgcacgctgccgcgccttctggcc
atcagccaggacgcgcaggccaccatcgccctcaccaccgacttcatctacggcatgggg
gagatgctcttcgagcaggcgccggagctgcgggagctgcactggatcgccacggacacg
ctggacgcggaggtcgccgaaggctggaaggaccccggcgtggccacggacacgcgggtg
ttcctccagtacacgtccggctccacgtcgtcgcccaagggcgtggtgctgacgcacggc
aacctgctgcacaactcaaagctgatccactcgtgcttcggtcactcggcggagagccag
ggcgtcatctggctgccgccgtaccacgacatgggcctcatcggcggcatcctgcagccg
ttgtacggcggcttcccggtgacgctgttctcgccggtggacttcctcaagcgccccatg
cgctggctggaggccatctcccgctacaaggccaccacgagcggcggtcccaacttcgcg
ttcgacctgtgcgtgcgcaagagcacgccggaggagcgcgcgaagctggacctgagccac
tgggacctggccttcaacggcgcggagcccatcatgccggacacgctccggcgcttcgcg
gaggcgttcggcccgcagggcttccgttcggaggccatctatccctgctacggcctggcg
gagggcacgctcatcgcctctggcggtgacaagcgcgagctgccggtgcagcgcaccgtg
gacgggggcgcgctgaaggacaaccgcgtggtggcgaaggaggcggcgagccccggcgcc
cagacgctggtgggctccggccgcaacctcacggatcagcgcctggtcatcgcgcatccg
gagacgggcgcgccgctgccggcgggccaggtgggcgagatccgcgtcgccggccccagc
atcgcgcagggctactggggccgcgaggagcagacgcgcaccaccttccagcagccgctg
gccggcacgggggacccgacgccgttcctgcgcacgggcgacctgggcttcctcgcggac
ggcgagctgttcgtcaccggccgtctgaaggacctgatcatcatccgcgggcgcaaccac
tacccgcaggacatcgagcgcacggtggagtccgcccaccccgccatccgccccggctgc
acggcggcgttctccatcgagcaggatgacgaggagcgcctgatcgtcgtgacggaggtg
gaccgccgcgcggtggagcgcgacggcgtggacctggacgcgctggcgcagggcatccgg
caggcggtcgcggccgggcacgacctgcaggcccagggcgtggtgctgctggggccgggc
gccatcccgaagacgtccagcggcaagatccagcgcttcgccacccgcgcggagtacgtc
gcggacacgctggaggcgctgcacaagagcgtcctcgccgccgcgcccgtccccgcgccc
gaggccgtgaagaccgccgccccggaagccgccgccgcgcccgcgcccgtgggcccggac
accagcatgctgcagaagatgctggcggtggtgacggacgccaccgcgcgccgggccatg
gtggcggtgttcctccaggagcaggccgcgcaggtgctgcggctgcccaccgcgcaggtg
gacgtgcagaagccgctgcatgcctacggcgtggactcgctgatggcggtggacttcaag
agcgcggtggacgcggggctgggcatcgacctgccgctgtcggacgtgctccagggcgtg
tcgctgtcgaagctggcggaggtcgtggtgacgctgatgtcggcgcccccgtcccagcag
gcctcgaacgcggtggccgcttcgtccgccacgggtgacgcgcccctgtccggtggacag
caggcgctgtggttcatgcaccagctcgcgccggagagcgccgcctaccacgtgcccgtc
gccgtgcgcgtgcgcgcggggctggacgccaacgccctgaagggtgccttcgaagcgctg
gtggcccgccaccctgccctgcgcaccacgttcgtcatggcggccaccggccccgtgcag
cgcgtgcacgcggagctgccgctggacttcaccaccacggacgcgaagggctggagcgac
gcgcaggtggcggagcacctgtccgccgaggcccgccgcccgttcgacctggagaagggt
cctctcctgcgcgtgcggctggtgtcgcggtccgcggaggaccacgcgctgctcatcgcg
atgcaccacatcgtcaccgacttctggtcgctggcggtgatggcggaggagctggacgcg
ctctacccggcgctgaagctgggcaagcggccctcgctggcgcagcccgcgcgcacctac
gcggactacgcgcgctggcagtcggagatgctcaccggggctcgcggccaggcgctggag
aagtactggcgcgagcagctgtccggcacgctgccggtgctggacctgcccacggaccac
ccgcgtcccccggcgcagaccttcaacggccgcgtccacaccacgcggctggacgcgagc
gtcgcgagcgcggtgaagacgctggcgcgtgaccacggcgccacgccgaacatggtgctc
cagacggcgttccaggtgctcctgcaccgttacaccggccagcaggacttcacgctgggc
gtggtgagcgcgggccgcggacgcgcggagctggcgggcatcacgggctacttcgtcaac
ccgctggtggtgcgcacgcggccgtcccccacgctgtccttcacggactacctggcccag
acgcgccagacgatgctgggcgcgctggagcaccaggactaccccttcagcgcgctcgtg
gaccggctgcagccggtgcgtgaccagagccgctcgccgctgttccaggtgatgttcgtc
taccagcgtgcctccaagctggacgagcgcggcctcacgcccttcgccctggacatcccg
ggcgcgaagtccaccgtggcgggcctgcccatcgagtcgctggtcctgtcgcacggcggc
gcgcagttcgacctcacgctcaccatgggcgaggcggacggcgagctggtggcctccttc
gagtacaacaccgacctcttcgaggccggcaccatcgagcgcatggccgggcacctggcc
acgctcctgtccggcatcgccgcgcagccgggccacgcgctcgcggggctgccgctgctc
acgcaggccgaacagcagcaactgctggagacctggaagggtcctcgcgttccgctcacg
caggcggacatgctccctgccctcttcgcggcgcaggtggcgcgcacgccggacaacgtc
gcggtcctcttcaaggacgcacagctcacctaccgtgagctggatgcgcgcgcggggcag
ctggccgcgtggctgcgcggcgcgggcgtgaagccgggcgacatcgtcggcatctgcctg
gagcgctccgtggagacgctcgtgtccgtgctggcggtgatggccgcgggtgcggcgtac
gtgcccatcgacccggcctatccctccgagcgtgtggccttcatcctgggcgacacgcag
gcgccggtgctgatcacccagtcgtggctccagcgcacactgccctccggcacgtccgcg
cgcacgctgttcgtggaccagccgctggacggtgcgctgtcctccgcgcccgccgcgacg
gtggcggccggggacctggcgtgcctcgtctacacctccggctccaccggccagcccaag
ggcgtgatgctggagcacgggggcctcgcgaacctggtgcgctcgttcgtggagtcctac
gcgcctggcgcgacggaccggatgctgccgctcacgtcggtggcctccgccagcttcgtg
ggcgaaatcctcccgctcctgtgcacgggtggcgcgctggtgctgcccaccgaggaggag
atcctcgaccaggagaagctgttccagctgatcacccgccacaccgtcaccatcgtgagc
acggtgcccgcggtcatcgccgggctcaacgcgcgcctggagcaactgccgccgctcaag
ctggtgctctccggcggcgaggcgctggtggccagcgacgtggagaagctgctcgccacg
gttccggtggtgaacggctacggcctcacggagaccaccgtgtgctccacctaccaccgc
atggcggtggaggacctccagggccacgcgtgggtgcccatcggccggcccgtcatcaac
acggacgtgtacgtgctggacgcggagcgcaacctgctgcccgtgggcgtcgccggtgag
ctgtacgtgggcggcctgggcgtggcgcgcgggtactggaagcggccggagctgaccacg
gagcgcttcgtcgcgaacccgttcgcctccgacaagggcgagcgcctgtaccgcacgggc
gaccgcgcgcgctggctgccggacggcgtgctcacgttcctgtcccgcgcggatgatcag
gtgaagatccgcggtttccgcatcgagctgggtgaggtggaggccgccgtgcgccgccac
ccggccgtgaaggacgcgttcctgatggcgcgcgaggattcgcccggcgacaagcgcctg
gtggcctacatggtgctgggcgagcccgcgcccacgcactcggacctgaacagcttcctc
gcggaagggctgccgccgtacatgctgccgtccgcgtacgtgccgctggccgcgctgccc
ctgtcgcccaacggcaaggtggatgcgaaggcgctgcccgcgccggaaggggcgcgcctt
gcgtccggcgtcgcctacgcccagccgcagagcgcggtggagcgcagcgtggccgccatc
tgggcggcggtgctgaaggtggagcgcgtcggcctcaacgacaacttcttcgagctgggt
ggcaactcgctgctcatcgcgcaggcccaccggcggctgaaggaagagctgggcgcggac
ctggcgctggtggacatgttcaagttcaccacggtgagcgcactggcccagcacctggcg
aacaagggcgaggactcgggcgcggcctcccagaagatcaaggacgaggcggagcgccgc
cgggccgcccaggcgcggcgtcagcaggcgcgcggccgtggcaagtaa

DBGET integrated database retrieval system