KEGG   Corallococcus coralloides: COCOR_05821Help
Entry
COCOR_05821       CDS       T01780                                 

Gene name
treS1
Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00500  Starch and sucrose metabolism
ccx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCOR_05821 (treS1)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     COCOR_05821 (treS1)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     COCOR_05821 (treS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AFE10528
UniProt: H8MGY8
LinkDB All DBs
Position
complement(7337372..7339036)
Genome map
AA seq 554 aa AA seqDB search
MIEDLWYKNAVVYCLDVETFMDGNGDGVGDFVGLRRKLDYLAGLGITCLWLLPFQPSPNR
DNGYDISDYYGVDPRLGDLGDFVAFTHEAKLHGIRVIIDLVVNHTSDQHPWFQAARKDPD
SNYRDYYVWAKKKPKDAHKGMVFPGVQPSTWTYDKEARLWYFHRFFHYQPDLNVANPEVR
EQILKVMGYWLELGVSGFRVDAVPFLVELKGVKNPDVKNPYKLLEEMREFLSWRKGDAIL
LAEANVTMNEVVEFFGDNDRMQMVFNFLANQNFYLALTRGDVTPLVQALKSSPKLPHTAQ
WANFLRNHDELDLGRLSDEDRLEVFEALGPDKGMQLYDRGLRRRFASMLDGDRRRIEVAY
SLMFSLPGTPVLWYGDELGMGENLSLVERQAVRTPMQWSPEPHGGFTLAQEPVKPLVSEG
PFGFRQVNVAQQRRDPGSQLNWTERIIRARKECPELGWGAWKVLRTGNKGVLAIRYEWKG
NALVVLHNLSARPCTVKLDPGGEEPCTLFNVLSEDHSEPVDGQRHVLTLEGYGYRWFRVG
LENPARKHRTEPLP
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagacctctggtacaagaacgcggtcgtctactgcctcgacgtcgagacgttc
atggacggcaacggcgacggcgtgggggacttcgtgggcctgcgccgcaagctggactac
ctggcgggcctgggcatcacctgcctgtggctgttgcccttccagccctcgcccaaccgc
gacaacggctacgacatcagcgactactacggcgtggatccgcgcctgggggacctgggc
gacttcgtggccttcacccacgaggcgaagctgcacggcatccgcgtcatcatcgacctg
gtggtgaaccacacgtcggatcagcacccgtggttccaggccgcgcgcaaggacccggac
agcaactaccgcgactactacgtctgggcgaagaagaagcccaaggacgcccacaagggc
atggtcttcccgggcgtgcagccctccacgtggacgtacgacaaggaggcgcgcctctgg
tacttccaccgcttcttccactaccagcccgacctcaacgtcgcgaacccggaggtgcgc
gagcagatcctcaaggtgatggggtactggctggaattgggcgtgtccggcttccgcgtg
gacgcggtgcccttcctcgtggagctgaagggcgtgaagaacccggacgtgaagaacccc
tacaagctgctggaggagatgcgcgagttcctctcctggcgcaagggggacgccatcctg
ctcgcggaagccaacgtcaccatgaacgaggtggtggagttctttggcgacaacgaccgc
atgcagatggtgttcaacttcctggcgaaccagaacttctacctggcgctcacgcgcggg
gacgtgacgccgctggtgcaggccctgaagtcctcccccaagctgccgcacacggcgcag
tgggcgaacttcctgcgcaaccacgacgagctggacctggggcgcctgtcggacgaggac
cggctggaggtcttcgaggccctgggaccggacaagggcatgcagctgtatgaccggggc
ctgcgccgccggttcgcgtcgatgctggacggagaccgccgccgcatcgaagtggcctac
agtttgatgttctcactgccggggactccagtgctctggtacggcgacgagctgggcatg
ggggagaacctgtcactcgtggagcggcaggcggtgcgcacgcccatgcagtggagcccg
gagccgcacggcggcttcacgctggcgcaagagccggtgaagcccctggtgtcggagggg
ccgttcggcttccggcaggtgaacgtggcgcagcagcgccgcgacccgggctcgcagctc
aactggacggagcgcatcatccgcgcgcgcaaggagtgcccggagctggggtggggcgcg
tggaaggtgctgcgcacgggcaacaagggcgtgctggccatccggtacgaatggaagggc
aacgcgctggtggtgctgcacaacctgtccgcccggccctgcacggtgaagctggatccg
ggcggcgaggagccgtgcacgctgttcaacgtgctgagcgaggaccactccgagcccgtg
gatggccagcgccacgtgctcacgctggaggggtacggctaccggtggttccgcgtgggg
ttggagaaccccgcgcgcaagcaccggacggagccgctgccctag

DBGET integrated database retrieval system