KEGG   Corallococcus coralloides: COCOR_07055
Entry
COCOR_07055       CDS       T01780                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
ccx  Corallococcus coralloides
Pathway
ccx03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    COCOR_07055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccx03400]
    COCOR_07055
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     COCOR_07055
DNA repair and recombination proteins [BR:ccx03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     COCOR_07055
 Prokaryotic type
     COCOR_07055
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-ProteinID: AFE07297
UniProt: H8MFX5
LinkDB
Position
complement(8865706..8866290)
AA seq 194 aa
MKRLPLSFYARPTLEVARDLLGTLLVVDGVRGRRVGRIVEVEAYLGEHDLACHSSKGRTP
RTEVMFGPAGRSYVYLIYGMHHCFNVVTDAPGVAAAVLVRGVEPVEGILPGERTDGPGRL
CRVMGLNLNHNDLKLDSEGLHLLRGTPVPDARVERGPRIGVEYAGAWAAEPFRLWDRDSG
HVSRFVSRRPRRRP
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaaacggcttcccctgtccttctacgcccggcccaccctggaggtggcgcgcgacctc
ctgggcaccctgctggtggtggacggcgtccggggccggcgcgtgggccgcatcgtggag
gtggaggcctacctgggcgagcatgacctggcgtgtcattcgtccaagggccgcacgccg
cgcacggaggtgatgttcgggccggcggggcgctcgtacgtctacctcatctatggaatg
caccactgcttcaacgtggtgacggacgcgcccggggtggcggcggcggtgctggtgcgg
ggcgtggagccggtggagggcatcctgcccggcgagcggacggacgggccgggacggctg
tgccgggtgatggggctgaacctgaaccacaacgacctgaagctggactcggaggggctg
cacctcctgcgggggacaccggttccggacgcgcgggtggagcgggggccccgcatcggc
gtggagtatgccggggcgtgggccgctgaacccttccggctgtgggaccgggacagtgga
cacgtcagccgcttcgtctcccggcggcctcgccgtcggccttga

DBGET integrated database retrieval system