KEGG   Campylobacter coli RM4661: YSS_05830Help
Entry
YSS_05830         CDS       T03166                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ccy  Campylobacter coli RM4661
Pathway
ccy00330  Arginine and proline metabolism
ccy01100  Metabolic pathways
ccy01110  Biosynthesis of secondary metabolites
ccy01130  Biosynthesis of antibiotics
ccy01230  Biosynthesis of amino acids
Module
ccy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ccy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    YSS_05830
Enzymes [BR:ccy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     YSS_05830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AHK77029
UniProt: W8KBE4
LinkDB All DBs
Position
1086273..1086974
Genome map
AA seq 233 aa AA seqDB search
MAQALAYGLKDSYNIYIVGRNLEKLQILEKEGFKTLLYKDFNIENKNIILAFKPYALESV
AANLKGKAKILISVLANTDFDKLKLIQAQNYARIMPNTAAKYKASTTPYVLKNSNFKDEV
IEILNTFGKAYALNEEKQMNAAMAISGCAPAFLALVAESIANAGVYEGLSKELSLNLTRS
LFKSAATLLENEHPAIIKENICSPAGVTIKGIKVLEQKGIRGTFFEALNASAT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagctttggcttatggattaaaagattcttataatatctatatagtcggtaga
aatttagaaaagcttcaaattttagaaaaagaaggttttaaaactttactctataaagat
tttaatatagaaaataaaaatattatcttagcttttaaaccttatgccttagaaagtgtc
gcagcaaatttaaaaggcaaggcaaaaattttaatttcagttttagccaatacggatttt
gataaattaaaacttatccaagcccaaaattatgcaaggataatgccaaatacagcagct
aaatataaagcttccacaactccttatgttttaaaaaattcaaattttaaagatgaagtc
atagaaattttaaatacttttggcaaggcttatgcgttaaacgaagaaaaacaaatgaat
gctgccatggctataagcggttgcgctcctgcttttttagcattagtagctgaaagcatt
gccaatgctggcgtgtatgaaggattatcaaaagagctgagtttaaatctcactcgttcg
ctttttaaaagtgctgcaaccttgctagaaaacgagcacccagccatcattaaggaaaat
atttgctcacctgcaggtgttactataaaagggattaaagtattagagcaaaaaggtatc
cgtgggactttctttgaggctcttaatgctagtgcaacatga

DBGET integrated database retrieval system