KEGG   Capnocytophaga cynodegmi: CGC48_00375Help
Entry
CGC48_00375       CDS       T05499                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccyn  Capnocytophaga cynodegmi
Pathway
ccyn00620  Pyruvate metabolism
ccyn00680  Methane metabolism
ccyn01100  Metabolic pathways
ccyn01120  Microbial metabolism in diverse environments
ccyn01200  Carbon metabolism
Module
ccyn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccyn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGC48_00375
  09102 Energy metabolism
   00680 Methane metabolism
    CGC48_00375
Enzymes [BR:ccyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CGC48_00375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATA67210
UniProt: A0A286NTA3
LinkDB All DBs
Position
complement(84419..86983)
Genome map
AA seq 854 aa AA seqDB search
MPRKTKLERFNENVLSKYQIYNGILMTLPYEEVLETGTLLPLFSEMCNKGYEENSSPVEI
VNNFFNKYLENPTEKQKNDLLFRFIQYIERQVVLFDAIEDASFAIVNNLDGLGSLRNVRE
KAESQEKTEQLKAYLRYAKVRPVLTAHPTQFYPGAVLAIINDLSEAIKKDDILLIKNLLA
QLGKTPFFKKEKPTPYDEAVNLIWYLENVFYHSVGTIYKYIYHNIFKDKRIDNEIIELGF
WPGGDRDGNPFVTAEITRKVAERLRRSVIRNYYKDLRNIKRRLTFPEVEPLISELEIKLY
NLSFLQKDDSILLDEFIEKLINIKQILIEKYQSLFVEKVDDLLHKIQIFGFHFATLDIRQ
DSRVHHSVIKDISRTLKGRILPENYGELSDKEQYECLINAKGILNSADFSDELTKQTIES
IYAIKEIQKFNGERGANRYIISNNQSSLNVLEILTMIRLCDWKNPSIDIIPLFETINDLS
VAERVMQELYTNSTYKEHLKNRNNIQIIMLGFSDGTKDGGYLMANWSIYQAKERLTEVSR
NNGVKVIFFDGRGGPPARGGGKAHQFYASLGNTIEAEQIQLTIQGQTISSNFGTLESSQY
NLEQLLSAGINNKVFNDNKNTLLTEEDKKVISELAQISYESYTNFKNHPMFIPYLERVST
LKYYAKTNIGSRPSKRSQSEGLNFSDLRAIPFVGSWSQLKQNVPGFYGVGTALKYLEEKG
NFDKAIYLYKNSLFFRALLENSMMSLTKSNFKLTQYMQNDAEFGEFWTLIYEEFELTKKM
LLKLTGYSELMENHQSGKASIEIREKMVLPLLTIQQYALQKIKNETFDSELVNIYEKMVM
RSMFGNINASRNSA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgccgagaaaaacaaaattagaacgatttaacgaaaatgtattaagtaaataccaaatt
tataatggtattttgatgacgcttccttatgaagaggttttggaaacgggaacgttgttg
cctctttttagtgaaatgtgtaacaaagggtatgaggagaattcctctccagttgaaata
gttaataatttttttaataaatatttagaaaatccaactgaaaaacaaaaaaatgattta
ttgtttcgtttcattcaatatattgaacgtcaggtagttttatttgatgcgatagaagat
gccagttttgctattgtaaacaatttagatggacttggttccctccgaaacgttcgtgaa
aaggctgagtctcaggaaaaaacagaacagttaaaagcatatctgcgttatgcaaaagtg
cgtcctgtacttacagcacacccaactcagttttatccaggagcggttttagcaattatt
aatgatttatctgaagcaatcaaaaaagatgatatattactcattaagaatcttttagca
caattgggaaagactcctttcttcaagaaagaaaaaccaacaccgtatgatgaagctgta
aatttgatatggtatttagagaatgtattttatcactctgttggaacaatttacaaatat
atatatcataacatatttaaagacaaacgtatagataatgaaatcattgaacttggattt
tggcctggtggtgatcgtgatgggaatccgtttgttacagcagaaataacgcgtaaggta
gcagaacgcctcagaaggtctgttattcggaattactataaagatttacgcaatatcaag
aggagattaactttcccagaagttgagcctctcattagtgaattggaaattaaattatac
aatttgagtttcctgcaaaaagatgattctattctgttagatgaatttattgaaaaattg
ataaacattaaacagattttgatagaaaaatatcaatcattatttgttgaaaaagttgat
gatttattacataaaatacaaatctttggatttcatttcgcaacacttgacattcgacaa
gattcacgagtacatcattccgtaataaaagatatatcaagaactctgaaagggagaata
ttacctgaaaattatggagaattatctgataaagagcaatatgagtgtttaataaatgca
aaaggaattctgaattcagctgatttttctgatgaacttaccaaacaaacgattgaaagc
atttacgctataaaagaaattcaaaagtttaacggcgaacgtggagcaaatcgttacatt
attagcaataatcaaagttcattaaatgtgcttgaaatactgacaatgattcgtttatgc
gattggaaaaatccaagtattgatattattcctctttttgagactattaacgatttgtct
gttgctgaacgtgttatgcaggaattatatacgaattcaacttataaagaacatttgaag
aatcgtaataatatacaaatcattatgttaggtttttctgatggaacaaaagatggcgga
tatttaatggcaaattggagtatctatcaagctaaagagcgtttaacagaagtctctaga
aataacggagttaaggttattttctttgacggaaggggaggacctcctgcacgtggtgga
ggaaaagctcatcaattttatgcatctttaggcaatactattgaggctgaacaaattcag
ttaacaattcagggtcagacgattagctctaattttggaactttggaatcttctcaatat
aacttggagcagttacttagtgcggggattaacaataaagtttttaatgataataaaaac
acattacttacagaagaagataaaaaagttatttctgaactagctcaaattagctatgaa
agttatactaatttcaaaaatcatccaatgtttattccttatttagagcgagttagcacg
ttaaaatattatgctaaaacaaatattggaagtcgtcctagtaagcgctcacaatcagaa
ggattgaatttcagtgatttaagagcgattccttttgttggaagttggagtcagttaaaa
caaaacgtaccaggtttttacggagtgggaactgctttaaaatatcttgaagaaaaagga
aactttgataaagctatttatttgtataagaactcattatttttcagagcgttacttgaa
aatagtatgatgagtttgacaaaatcaaattttaaattaacacaatatatgcaaaatgat
gctgaatttggagaattttggacattaatttatgaagaatttgagttgacaaaaaaaatg
ttattgaaactgacaggctattcagagttgatggaaaatcatcaaagcggaaaagcatct
atagagattcgtgaaaaaatggttttaccattattaacaattcaacaatatgcattacaa
aaaattaaaaacgaaacttttgatagtgaattagtaaatatttatgaaaaaatggtaatg
cgttcgatgtttggtaacattaatgctagccgaaattcagcataa

DBGET integrated database retrieval system