KEGG   Capnocytophaga cynodegmi: CGC48_06340Help
Entry
CGC48_06340       CDS       T05499                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ccyn  Capnocytophaga cynodegmi
Pathway
ccyn00240  Pyrimidine metabolism
ccyn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccyn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CGC48_06340
Enzymes [BR:ccyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CGC48_06340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ATA68281
UniProt: A0A0B7H6Z2
LinkDB All DBs
Position
complement(1441976..1442557)
Genome map
AA seq 193 aa AA seqDB search
MFLENTTNHSEKFGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPAFDTRYDEGK
VVSHNSNEIQSTPVPAATNILLLADGCDVVGIDEAQFFDDEIVNVCNDLANRGMRVIVAG
LDMDYKGKPFGPMPALMATAEYVTKVHAVCTRTGNLAHFSYRKSDDENLYMLGEQDSYEP
LSRAAFFKAMKNK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaatactacaaatcattcggaaaaatttggctggatagaagttatctgt
ggctcaatgttttccggaaaaacggaagaattaattcgaaggcttcgacgggcacaattt
gcaaagcaaaaagtagaaatttttaaacctgcattcgacactcgttatgacgaaggaaaa
gtagtttcgcataattccaacgaaattcaatcaacccctgttcctgcagctacaaatatt
ttgctcttagccgatggttgtgacgttgtaggcattgatgaagctcaattttttgatgac
gaaattgtgaatgtttgcaatgatttagctaacagaggtatgcgtgtaatcgttgctggg
ttggatatggattacaaaggaaagccttttggtcctatgcctgcgttaatggctaccgcc
gaatatgtgactaaagtacacgctgtttgcacacgtactggcaacttagctcatttcagt
tacagaaaatctgacgatgagaatctgtatatgttaggagagcaagattcttacgagcct
ttaagtagagccgcattttttaaagcaatgaaaaataagtaa

DBGET integrated database retrieval system