KEGG   Chthonomonas calidirosea: CCALI_01521Help
Entry
CCALI_01521       CDS       T02699                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ccz  Chthonomonas calidirosea
Brite
Enzymes [BR:ccz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CCALI_01521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCW35337
UniProt: S0EYZ7
LinkDB All DBs
Position
complement(1790996..1791616)
Genome map
AA seq 206 aa AA seqDB search
MPEFTLPPLPYPYNALEPYIDAQTMQIHYEKHHGGYVANLNAALKDYPSFFEKTPEEIIS
NLDAVPEAVRTAVRNNGGGHVNHTMFWEIMKPGGSKEPTGALAEAIRSTFGSFDALKQQI
NDAGLKRFGSGWAWLVLDSSGKLSVISTPNQDNPLMEGKKPILGVDVWEHAYYLKYQNRR
ADYLNAWWNVVNWDEVAKRYEAALKG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatttaccctgccacctcttccctatccctacaacgcgctagagccctacatt
gacgcccaaacgatgcagatacactatgagaagcatcatggaggctatgtggccaatctc
aacgcggctttgaaggactatccgagttttttcgagaagacccctgaagagatcatctcc
aatctcgacgcggtgcccgaagcggtacgcacggccgtgcgcaacaacggcggcgggcat
gtgaaccacacgatgttttgggagatcatgaagccgggcggcagcaaggagccaacgggg
gcactcgccgaggccattcgctcgacttttggcagcttcgatgccctaaagcaacagatc
aacgatgccggcttaaaacgcttcggcagcggctgggcctggttggtcctcgactcgtcc
ggtaagctctccgtgatctccacacccaaccaggacaatcccctgatggagggcaaaaag
cctattctcggcgtggacgtttgggagcacgcctactatctgaagtaccaaaaccgacgc
gccgactatctcaacgcctggtggaacgttgtgaactgggacgaggtggccaaacgctac
gaggcggctttgaaaggctag

DBGET integrated database retrieval system