KEGG   Chthonomonas calidirosea: CCALI_01558Help
Entry
CCALI_01558       CDS       T02699                                 

Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ccz  Chthonomonas calidirosea
Pathway
ccz00500  Starch and sucrose metabolism
ccz01100  Metabolic pathways
ccz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCALI_01558
Enzymes [BR:ccz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     CCALI_01558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Big_7
Motif
Other DBs
NCBI-ProteinID: CCW35374
UniProt: S0EUP7
LinkDB All DBs
Position
1841086..1843656
Genome map
AA seq 856 aa AA seqDB search
MPKIRAFHIVPALPEPLQKLRTLAYNLRWAWDHETIELFRSLDRNLWEQCEHNPVRMLSL
ISQERLTEAAADDAFLAEVDHVHYSLQTYLTTTNTWYRRQWADKLPPETCIAYFCMEFGL
TECLPIYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFKQTLSPDGWQQETYPENDF
YSMPLQAVLNEKGEPLKVCLDLLGRQVSICVWRAQVGRVPLFLLDTNLPENRPEDQDITD
QLYGGDAEMRLRQEMVLGIGGMRALRALKIRPTVCHLNEGHAAFTALERARELREETGCD
YATAREVAAAGSLFTTHTPVPAGFDVFSADLMNRYFAAYAQQLGLSFDELMGLGRVNPWD
QSEQFNMAVLAVRHAHQVNGVSQLHARVTRRMMQAGYPGFPEEEVPASYVTNGVHLRSFA
SMEMAELLDKYLGGRWSYDGHHEGVWERIEEIPDELLWRVKETRREKLVRFARARLRAQL
ERRYFRDDPEFRAAAEVLDPHALTIGFARRFAPYKRATLLLTDLDRLIRLLTNPQRPVQI
LFAGKAHPREDAGKELIRQIVQFSKRPEVRGRILFLEDYDLNVSRYMVQGCDVWLNTPRR
PMEASGTSGMKALVNGGLHVSVLDGWWAEGYDPRAGWAIGRGEEYSDPQEQDRIEATALY
NLLENEVVPLFYDRGMDGVPRAWVARVKYSMRTLCPRFNTHRMVSEYATRYYFPATLRCL
KLRANNLERARTLVDWKQRVRSLWPQVRIQEVITSPEEGATLQVGDKLKITVKAFLAGLT
PEDVRVQAYSGSLDADRRLKAESIVDIPFTGQEGELFCFQVEMPCSASGLRGFSVRILPA
HPDAQLPAELPLICWE
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaattcgcgccttccatattgtccctgccctacccgagccgcttcaaaagcta
cgaacgctggcctataacctgagatgggcctgggaccatgagacgatcgagctctttcga
agtctggatcgcaatctttgggaacagtgtgagcataacccggttcgcatgctgagcttg
atctctcaagagcgccttacggaggcggctgccgacgatgcctttctcgctgaggtagac
catgtgcactatagccttcaaacctatctcaccaccaccaacacctggtatcggcgccaa
tgggcggacaaacttccccccgaaacctgcatcgcctacttctgcatggagttcgggctt
acagaatgtctacctatctattccggcgggcttggcgttctagcgggcgaccatctgaaa
tcggctagcgacctcggcctgccgcttgtgggcgtggggctgctgtatcaacagggctac
tttaagcagaccctctctcccgatggctggcaacaggagacctatccagaaaacgacttc
tactccatgcccttgcaggcggtactgaatgaaaagggcgagccccttaaagtgtgtctc
gacctgctaggacgacaggtttccatatgtgtatggcgggctcaggtggggagagtgcct
ctcttcttgctcgataccaacctgccagaaaatcgccccgaagaccaggatatcaccgac
caactctacggcggcgatgccgagatgcggctgcggcaagagatggtgctgggtatcggt
ggcatgcgcgctttgcgtgctttgaagatacgcccaacagtgtgccatttgaacgagggg
cacgccgcctttaccgctttggagagggcacgagagctgagagaggagacggggtgcgac
tatgccacggcgcgtgaggtggccgcagctggcagtctgttcaccacccacacccctgtc
cctgccggcttcgatgtcttttctgcggatttgatgaaccgctacttcgccgcctacgcc
caacagctagggctgtcgtttgatgagcttatgggtctgggacgcgtgaacccgtgggac
caaagcgagcagttcaacatggccgttttggccgtgcgtcatgcccatcaggtaaatgga
gtgagccagctccacgcacgggttacgcgccgcatgatgcaagcgggctatcctggcttt
cccgaagaggaggttcccgctagctacgttaccaacggagttcatctgcgctccttcgcc
tccatggagatggcggagctgctcgataagtacctgggcgggcgctggtcgtacgacggt
caccatgaaggcgtatgggaacgcatcgaggagatacccgacgaactgctttggcgggtc
aaagagacgcgccgagagaagctggttcggtttgcgcgagcgcgcctgcgggcgcaactg
gagcggcgctatttccgagacgatccggagtttcgtgccgccgctgaggtcttagaccct
catgcgctgaccataggctttgcacgacgctttgcgccctacaaacgcgcgaccctcctc
ctaactgacctagaccgcctcatccgattgcttaccaacccacagaggccggtacagatt
ctctttgcaggcaaagctcatccccgtgaggatgcagggaaggagcttatccgacagatc
gtgcagttttctaagcggccggaggtccgaggacgaatccttttccttgaagactacgac
ctcaacgtaagtcgctacatggtacaaggatgtgacgtatggcttaacacccccaggcgc
ccaatggaagccagcggaacaagtggcatgaaagccctcgttaacggggggcttcacgtc
tcggtgctcgacggctggtgggctgaaggctatgatccgcgcgcgggatgggcgattggg
cgaggggaggagtactccgatccccaagaacaggacaggatagaggccaccgcactctac
aatctcttggaaaacgaggtcgtgccgcttttctacgataggggcatggatggagtaccc
cgcgcatgggtcgctcgagtaaaatactccatgcgcacgttgtgccctcgctttaacacg
caccgtatggtgagtgaatatgccacacgatactattttcccgctacgttgcgatgccta
aagctaagggcgaacaacctagagcgagcacgtacgcttgtggattggaaacagagggtt
cgtagcctctggcctcaagtgcgtatccaagaggtcatcacttcgcccgaagagggcgcc
acactgcaagtgggtgataaactcaagataaccgtgaaggcctttttagctggcttaaca
ccggaggatgtccgcgtgcaggcctatagcggctctctggatgctgatcggcggttgaaa
gcggagagtattgtggatatccctttcaccggccaagaaggcgagctgttctgctttcaa
gtggagatgccctgtagcgccagtgggcttcgaggcttctcggtgcgtattcttcccgct
catccagacgcccaactgcctgcagagttaccccttatttgctgggaatag

DBGET integrated database retrieval system