KEGG   Chthonomonas calidirosea: CCALI_02121Help
Entry
CCALI_02121       CDS       T02699                                 

Definition
(GenBank) Alpha-amylase/alpha-mannosidase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
ccz  Chthonomonas calidirosea
Pathway
ccz00500  Starch and sucrose metabolism
ccz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCALI_02121
Enzymes [BR:ccz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CCALI_02121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: CCW35928
UniProt: S0EZM3
LinkDB All DBs
Position
complement(2495792..2497033)
Genome map
AA seq 413 aa AA seqDB search
MTLVTFFFFAHQPFRLSAYEQRGSHRDLAPEKFYDTYFDDTLNRQIFHRVAEKCYYPASR
LLLELIREHKDTEKPFKFAFGLSGTLLEQAQRYDPGVIALWQELAATGCVEFTGETYYHS
LSSLFPGDKTEFHEQCRLHADTIERLFGRRPTVFRNTECLYNDSVAWHVQQMGYQGIITE
GVDWVLEGWRSPDFVYEAPCGLPVLLRNYRLSDDIAYRFPNRHWDQWPLDAEKFAFWLST
NTDMNVLLAMDYEAFGEHIWADTGIFDFLRNLPGAIKRHPQLEFVTPTEAIHRLPRVGTI
HVHDFATISWADKERDTSAWLGNEMQQFAFEEIKRMEKPIRATGHPEFLRTWRLLQTSDH
LYYLSTKALSDGDVHQYFSAYGSLFEAFIRLQTALSDLLHRAERYVEQGSSAP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgacccttgtcaccttcttttttttcgctcatcaaccgtttcgtcttagcgcgtatgag
cagcgcggttcacatcgcgacctggctccagagaagttttacgatacctactttgacgat
actctgaaccgacagatatttcaccgtgttgccgaaaaatgctactacccggcttccagg
ctcctgctagagcttattcgtgagcacaaggacacggaaaaaccgtttaagtttgctttt
gggctctccgggacgcttttagagcaggctcaacgctacgatccaggggttattgcgctt
tggcaagagcttgcggccaccggttgtgtggagttcaccggtgagacctactaccactcc
ttaagtagccttttccctggagataagaccgagttccatgagcagtgtcggcttcatgcc
gacaccatcgagagactatttggcagacgtcccaccgtttttcgcaacacggagtgcctt
tacaacgactcggtagcatggcatgtacaacaaatgggctatcagggcattatcacggag
ggcgtggactgggttttggagggatggcgctcgccggatttcgtctatgaagcgccctgt
ggcctgcccgtgctgctgcgaaactaccgcctctccgacgatattgcctatcgttttcca
aaccgtcattgggatcagtggcctttagatgccgaaaagtttgccttctggctctctacc
aacaccgatatgaacgtgctcttggctatggactacgaggctttcggagagcacatctgg
gcggatacgggcatcttcgactttctgcgcaatcttcctggagccattaagcgtcacccg
caactcgagtttgtcacgcccacagaggccattcatcgtctgcctcgcgtgggtaccatc
cacgtccacgatttcgcaaccatttcatgggcagacaaagagcgcgatacctccgcttgg
ttgggcaatgagatgcaacagtttgcttttgaagagatcaagcgcatggagaagcccatt
cgtgccacgggccacccagagtttttgcgcacttggcgcctgctgcagacaagcgaccat
ctctactacctttcaacaaaagccctgagcgatggagatgtccatcagtactttagtgcc
tacggctccctctttgaggcttttatacgcctccaaacggccttaagtgacctgcttcat
cgggcagagcgttatgtcgagcaaggctcctcggctccttaa

DBGET integrated database retrieval system