KEGG   Chthonomonas calidirosea: CCALI_02635Help
Entry
CCALI_02635       CDS       T02699                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenases
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
ccz  Chthonomonas calidirosea
Brite
KEGG Orthology (KO) [BR:ccz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCALI_02635
Enzymes [BR:ccz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CCALI_02635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP ADH_N_2
Motif
Other DBs
NCBI-ProteinID: CCW36428
UniProt: S0EXL0
LinkDB All DBs
Position
complement(3108316..3109425)
Genome map
AA seq 369 aa AA seqDB search
MVSIHGELPKTMKAVRCHGPEDYRLEEVGVPMPGPGEVLVRVEACGICASDVKCFMGAPL
FWGDAFRKGYVQAPVTAGHEFIGRVVALGEGAAERHGLKVGDRAISEQIVPCGNCRYCRT
GRYWLCLVHDIYGFHTYTHGGMADYMLFPDRALVYKVPDELPVEKAALIEPLACSMHAVE
RAQIQFGDVVVIAGAGPLGLGMIACARLKNPGCLISVDKSDQRLQLAQNLGADRILNPDK
TDVVQEILDLTDGYGCDVYIEATGHPDAVNQGLRAIRKGGNFVEFSVMKEPTTTDWTIIG
DTKELNIYGAHLGPGCYPKVIDYLNRGLLKTDGIVTHKLPLERYLEGFRMVQAGRESIKV
LLQPSDGTK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtctctatccatggtgaactaccgaaaacgatgaaggccgttcgatgccacggcccc
gaagactatcgtttagaggaagtaggtgtgcccatgcccggccccggcgaagttcttgtg
cgtgtggaggcatgtgggatctgtgcgtctgatgtgaagtgctttatgggtgcgcccctc
ttttggggcgatgcctttcgaaaaggatatgtgcaagcccccgttaccgccggccatgag
ttcatcgggcgggtcgttgctttaggagaaggggctgcagagcgacacggtcttaaagtg
ggcgatagggctatttctgaacagattgtgccttgtggtaactgccgctactgccgcacc
ggccgttactggctctgcctcgttcatgatatctatggcttccatacctacacgcatggg
ggcatggccgattacatgctcttccctgatcgcgcccttgtctacaaagtgcccgacgaa
ctgccggtggaaaaggccgctcttatcgaaccgcttgcctgctcgatgcacgccgtagag
cgagcgcaaattcagtttggcgatgtcgtcgttatcgcaggggctggaccgctagggctc
ggcatgatcgcctgcgcccgtctcaagaacccaggatgccttatctccgtggataaaagc
gaccaacggctgcagctagctcaaaacctgggcgccgaccgcatcttgaacccagataag
accgatgtcgtacaggagatcctcgatcttaccgacggatatggctgcgatgtctatatc
gaggcaacgggccatccggacgcggtgaaccaggggctacgtgccatccgtaaaggaggc
aactttgtggagttctctgtgatgaaagaaccaaccaccaccgactggacgatcatcggc
gacaccaaagagttgaacatctacggtgcgcacttggggccgggctgctacccaaaagtg
attgactacctgaatcgcggcctgctaaaaacggatggcatcgtgacgcataagttgcct
ttggaacgatacctagaaggctttcgtatggtgcaagcagggcgcgagtccattaaagtc
ctcctgcaaccttcagacggtacgaagtga

DBGET integrated database retrieval system