KEGG   Corynebacterium diphtheriae HC04: CDHC04_1974
Entry
CDHC04_1974       CDS       T01696                                 

Gene name
glnH
Definition
(GenBank) putative extracellulare solute-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
cda  Corynebacterium diphtheriae HC04
Brite
KEGG Orthology (KO) [BR:cda00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cda02000]
    CDHC04_1974 (glnH)
Transporters [BR:cda02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    CDHC04_1974 (glnH)
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Other DBs
NCBI-ProteinID: AEX81965
LinkDB
Position
2108102..2109049
AA seq 315 aa
MKRRALLTATAATAALCLNSCAQSVPPVELVDIPPLPLPAGATVGSPASGTIQTDNLLGS
LRPNGDDVPQVRQRGYLIVGIDQSQNLLSFRDTDGELKGFEVDLAREVARDIFGEPKIDF
RYVDSSSWVKTLEDGQVDMVLRSISVTRERQDQVFFSTPYFSGKTRILTQKDSDIHGAAD
LKGTVCVTNLSTGSKRLGTIAPNSTMLAVRNSADCLLALQQNHADAVISDDAILSGMIAQ
DPFTHIVGEPLATEQYAVAFAKPRTGRDTAPMIRQVNSTFERIFRDGTWASTYNHWFGAY
LAPQEHPAVHYREER
NT seq 948 nt   +upstreamnt  +downstreamnt
gtgaaacgccgtgcacttttgaccgccaccgcagccacagcagcgctgtgcctgaacagt
tgtgcacaatcagttccgcccgtagagctggtcgacatcccaccgctgccgctccccgcc
ggcgccaccgtaggatctcctgccagcggcacaatccaaacggataacctgctgggatcc
ctacgccccaacggtgacgacgttccccaggtccgtcagcgcggctacctgatcgtgggt
atcgaccaatcccaaaacctgttgagcttccgcgacaccgatggtgagctcaaaggcttt
gaggttgacctcgcccgcgaagttgcacgcgatatatttggcgaacccaaaattgacttc
cgctacgtcgattcctcctcctgggtcaaaaccctcgaagacggacaggtggatatggtg
ctgcgctctatttccgttacccgcgaacgccaagaccaagtgttcttttccaccccgtac
ttctccggtaaaacgcgcattcttacccaaaaagactccgacattcacggcgcagcggat
cttaaaggaacagtctgcgtgaccaacctgtccaccggctccaaacgcctaggcaccatc
gcaccgaattccaccatgcttgccgtgcgcaactccgcagactgcctgctcgcgctccaa
caaaaccacgccgacgcagtgatctccgacgatgccatcctttctgggatgatcgcccaa
gatccttttacacacatcgtgggtgagccccttgccaccgaacaatatgcggttgctttt
gccaaacctcgcacgggacgcgacaccgcgccgatgattcgccaagtaaactccaccttt
gaacggatattccgcgacggcacctgggctagcacctacaatcactggttcggtgcctac
ctcgcaccacaggaacatccggctgtgcactatcgggaggaacgatga

DBGET integrated database retrieval system