KEGG   Corynebacterium diphtheriae HC04: CDHC04_2039Help
Entry
CDHC04_2039       CDS       T01696                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
cda00010  Glycolysis / Gluconeogenesis
cda00071  Fatty acid degradation
cda00350  Tyrosine metabolism
cda00625  Chloroalkane and chloroalkene degradation
cda00626  Naphthalene degradation
cda01100  Metabolic pathways
cda01110  Biosynthesis of secondary metabolites
cda01120  Microbial metabolism in diverse environments
cda01130  Biosynthesis of antibiotics
cda01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC04_2039 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDHC04_2039 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CDHC04_2039 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDHC04_2039 (adhA)
   00626 Naphthalene degradation
    CDHC04_2039 (adhA)
Enzymes [BR:cda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDHC04_2039 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short TrkA_N ThiF
Motif
Other DBs
NCBI-ProteinID: AEX82028
LinkDB All DBs
Position
complement(2177564..2178604)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPTEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcaccgccgctgttgtggacaagtttggctcc
gagctcaacatccacgacgttgacctcccagagccaggccaacaccaagcactggtcaag
gtgctcacctccggcatctgccacactgacctccacgccgccgaaggcgactggccagtc
aagccaaagccaccattcgtcccaggccatgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcacagtgttgcgctgggtgacatggtcggtaacgtctggctctggtcagcc
tgtggcgagtgcgagtactgtcgcaccggctgggagactatgtgcgagaaagccgagtac
ggtggatacaccgtcgatggttccttcggacagtacatgctggtagacacccgttactgt
gcccgaatcccagacggctgtgacctgctggaagtcgccccaattctgtgcgctggcgtg
accgtgtacaagggcctgaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctaggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaaaaagcatggcgctgagttt
gtggtcaatgctcgtgaagaagacccaactgaggcaattgtgaagtacaccaagggtggc
gcacacggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccagcaccg
atcttcgacatcgtgttcaagggcctgaccatacgcggctccctcgtgggaacgcgccaa
gacctcgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacggc
cgcatggctatccgctactag

DBGET integrated database retrieval system