KEGG   Corynebacterium diphtheriae BH8: CDBH8_1601Help
Entry
CDBH8_1601        CDS       T01698                                 

Gene name
pknL
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdb  Corynebacterium diphtheriae BH8
Brite
KEGG Orthology (KO) [BR:cdb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdb01001]
    CDBH8_1601 (pknL)
Enzymes [BR:cdb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDBH8_1601 (pknL)
Protein kinases [BR:cdb01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDBH8_1601 (pknL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: AEX49119
LinkDB All DBs
Position
1657738..1659930
Genome map
AA seq 730 aa AA seqDB search
MADLKIGDVLENRYRIEAPIARGGMSTVYRCVDTRLGRLVAAKVMDQRYLDDPIFKDRFR
REARSMAQLSHPCLVGVYDFSSDGDNIFLIMELITGGTLRELLAERGPMPPHAAVAVMRS
VLTGLSVAHSAGMVHRDIKPDNVLINADHQVKLADFGLVRAASASQATSNQIVGTVSYLS
PEQVSGDDIGPESDVYSAGIVMFELLTGTTPFSGDNQIAHAYARLDSAVPAPSSMIAGIP
PLIDALVASATALRPEERFADAAEFLNALDDVAQELRLPEFRVPVPANAAAYRSNEHLTG
HFTTSDLMTTDLPRETEGLFPIEDASTHTRAFQPITPQPATPIGPVAQRKPDYSPEPVAP
QHAPAATHEPVTNRSKISFVLWLIAVITLATAVALGAWWFGSGRYGEVPQVLGLDQVQAV
AVTEESGFGAVTEPVYSDDVPKNAIAGTKPDQGQRAVKGDDITLLVSQGRPTVPDVPQSR
SASEYRRLLEERTLEYRESAPEFSDSVPEGKIARVVPGSGNEVAVGSAVSVALSQGPAPV
TIPNVSERPVDQARNELEKLGFDVTIAKEFSDTIPGGDAIGTDPAAGTTLPRGSSVTLKV
STSVEIPDVRGKSRHAAISALADAGITVESISRSDNEVGNSADEVTSITPSSGNLIDPAH
TKVSLILAGRVEVPSVVGKRYAEAKRELEAAGFSVTTSGTSKSSARVYWQTPAGGRAEPG
ATIKLKTLSS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcagatctgaaaatcggcgacgtgctagaaaaccgttatcgcatcgaggctcctatt
gctaggggtgggatgtcaacggtctaccggtgtgtggatacccgcttgggtcggcttgtc
gctgcgaaagtaatggatcagcgttatctagacgacccgattttcaaagaccgcttccgt
agggaagctcgctccatggcccagttgagtcacccatgtttggtgggagtctatgacttt
tcttccgatggcgacaacatcttcctcattatggagctgatcaccggcggcactttgcgc
gagcttttggccgaacgcgggcctatgcctcctcatgcagcggtcgccgtcatgcgttcg
gttctgactggtttgtccgtagcccactcggcgggcatggttcatcgcgatatcaaaccc
gacaatgtgctaatcaacgccgatcatcaggtgaagttggcggactttggtttggtgcgg
gcggcgtcggctagccaagcgacttccaatcaaatcgtcggcacggtgtcttatctctcc
cctgagcaagtttctggcgatgacatcggacccgaaagcgatgtgtactccgccggcatc
gtgatgttcgagttactcaccggcaccactccgtttagcggcgacaatcaaattgcgcat
gcttacgcgcgtctcgatagcgcagtgccagcaccttcatccatgatcgcaggaattcca
ccgcttatcgacgccctcgttgcttctgctacagcgctacgccccgaagaacgcttcgcc
gatgcagcagagtttctcaatgcgctagacgacgtagctcaagaactacgtctcccagaa
ttcagagtgccagtacctgccaatgctgcagcttaccgttccaatgaacatctcactggc
catttcacaacgtccgatctcatgactacggacctgccgagagaaactgaaggcctgttc
cctatcgaagacgccagcactcatactcgcgccttccaaccaattacgccacagcctgct
acccccatcgggcctgttgcacaacgaaaaccagactattctcctgaaccagtagcacca
caacatgccccagctgcaacgcatgagcccgtcaccaatcgttccaaaatcagttttgtt
ttatggctcatagctgtcattaccctagccaccgcggtagcccttggcgcatggtggttt
ggttctggacgctacggtgaagtcccccaggtccttggcctcgaccaagtgcaagccgta
gccgttaccgaggaatccggctttggcgcagtcaccgagcctgtatatagcgacgacgtt
cctaaaaatgccatcgctggcacgaaaccagaccagggccaacgtgctgtgaaaggtgac
gacatcacgttgctggtatcccaaggacgcccgaccgttcccgatgttcctcaaagtcgt
tcagcttccgagtaccgtcgcctgctcgaagagcgcacacttgagtaccgcgaaagcgcc
cccgaattttctgattccgtgcccgaaggaaaaatcgcccgtgttgtaccaggttcgggc
aacgaagtcgcagtcggcagtgccgtatcagttgcactttcccaaggtccagcgcctgtg
accatccccaatgtttctgaacgtcccgttgatcaagcgcgaaacgagctggaaaaacta
ggattcgacgtcaccatcgccaaagaatttagtgacaccatccctggcggtgacgcaatc
ggtaccgaccccgcagcaggcacaactctcccccgcggcagctcagtaactcttaaagtt
tctacctctgtggaaatacctgatgttcgtggaaaatcgcgccatgctgccatcagcgct
cttgctgatgcaggtattaccgtggagtcgatttctcgttccgataatgaagtaggcaat
tctgcagacgaggtcacatcgattacaccaagctctggtaatctcatcgatcctgcacat
accaaagtctcgttgattcttgcgggcagagtcgaagtgccttctgttgtaggtaaacgc
tacgctgaggctaaacgcgaactagaggcagcaggctttagcgtgaccacaagcgggacg
agcaagtcttctgcacgagtgtattggcagactcctgccggtggacgcgctgaaccaggg
gctaccatcaaactcaaaaccctgagctcttag

DBGET integrated database retrieval system