KEGG   Clostridioides difficile CD196: CD196_0063Help
Entry
CD196_0063        CDS       T00997                                 

Definition
(GenBank) elongation factor TU
  KO
K02358  elongation factor Tu
Organism
cdc  Clostridioides difficile CD196
Brite
KEGG Orthology (KO) [BR:cdc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cdc03012]
    CD196_0063
   03029 Mitochondrial biogenesis [BR:cdc03029]
    CD196_0063
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdc04147]
    CD196_0063
Translation factors [BR:cdc03012]
 Eukaryotic Type
  Elongation factors
   CD196_0063
 Prokaryotic Type
   CD196_0063
Mitochondrial biogenesis [BR:cdc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CD196_0063
Exosome [BR:cdc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CD196_0063
  Exosomal proteins of breast cancer cells
   CD196_0063
  Exosomal proteins of colorectal cancer cells
   CD196_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: CBA60157
UniProt: A0A0G2PMH9
LinkDB All DBs
Position
87574..88767
Genome map
AA seq 397 aa AA seqDB search
MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKTLYDRYQLGEAVDFANIDKAPEERER
GITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSATDGPMPQTREH
ILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLTEYDFPGDDTPIVRGSALMAL
EDPKSEWGDKIVELFEQIDEYIPAPERDTDKPFLMPVEDVFSITGRGTVATGRVERGVLK
VQDEVELVGLTEAPRKVVVTGVEMFRKLLDQAQAGDNIGALLRGVQRNEIERGQVLAKTG
SVKAHTKFTAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTDVTGACKLPEGIEMVMPGDNV
TMEVDLINSIVVEEGLRFSIREGGRTVASGVVATIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagctaaatacgaaagaacaaaacctcatgttaatatagggacaataggacac
gtagaccacggtaaaactacattaacagcagcaataacaaaaacattatatgacagatat
caattaggagaagcagtagatttcgcaaacatagataaagctccagaagaaagagaaaga
ggaatcacaatatcaacagcacacgttgagtatgaaacaccaaatagacactatgcacac
gttgactgcccaggacatgctgactacgttaagaacatgataacaggagcagcacaaatg
gacggagcaatattagtttgttcagcaacagatggaccaatgccacaaacaagagagcat
atactattatcaagacaagttggagtaccatatatagtagtattcttaaacaaatgtgac
atggtagatgatgaagagttattagagttagtagagatggaagtaagagatttattaaca
gaatatgatttcccaggagatgacactccaatagtaagaggttcagcattaatggcatta
gaagatccaaagagcgagtggggagataagatagtagaattattcgagcaaatagatgag
tatataccagctccagagagagatacagataagccattcttaatgccagtagaggatgta
ttctcaatcacaggaagaggaacagttgcaacaggaagagtggaaagaggagtactaaaa
gtacaagacgaagtagaattagtaggattaacagaagcaccaagaaaagtagtagtaaca
ggagtagagatgttcagaaaattattagaccaagcacaagcaggggataatataggagca
ttattaagaggagtacaaagaaacgagatagaaagaggacaagtactagcaaagactgga
tcagtaaaggcacacacaaagtttacagcagaagtatatgtacttaaaaaagaagagggt
ggaagacatacaccattctttgatggatatagaccacaattctatttcagaacaacagac
gtaacaggagcttgtaagttaccagaaggaatagagatggtaatgcctggagataacgta
acaatggaagtagacttaataaactcaatagttgtagaagagggattaagattctcaata
agagaaggtggaagaacagtagcttcaggagttgttgctacaataatagagtaa

DBGET integrated database retrieval system