KEGG   Clostridioides difficile CD196: CD196_2417Help
Entry
CD196_2417        CDS       T00997                                 

Gene name
stk
Definition
(GenBank) serine/threonine-protein kinase and phosphatase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdc  Clostridioides difficile CD196
Brite
KEGG Orthology (KO) [BR:cdc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdc01001]
    CD196_2417 (stk)
Enzymes [BR:cdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CD196_2417 (stk)
Protein kinases [BR:cdc01001]
 Serine/threonine kinases: Other
  Bacterial family
   CD196_2417 (stk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH YL1 Kdo Kinase-like RIO1 CDC45 Pkinase_fungal GEN1_C Connexin Fructosamin_kin VKG_Carbox
Motif
Other DBs
NCBI-ProteinID: CBA64633
UniProt: A0A0H3N4L7
LinkDB All DBs
Position
complement(2807941..2809956)
Genome map
AA seq 671 aa AA seqDB search
MGDTILGNRYEIIRKIGDGGMAFVYEAKDRLLNRTVALKVLRPEFVDDDEFLTKFKREAE
AVASLSHPNIVNVYDVGEDGKVHYIVMEFVDGKNLKEIIQDEGILDEYTALDITKQIAMA
LSAAHKKGIIHRDIKPHNILISNEGRVVKVADFGIAKAVSNSTMTNIGSIIGSVHYFSPE
QAKGKFVTNNADLYSLGIVLYEMLIGKVPFRGDSPISIALQHINDDIDFTSEEKVRIPQS
VRTTIKKLTEKSSADRYQTAEELIEDIEYIEKNIDLDFIKEYDDFATKKIDEKEINKVVN
PTLAKPAPEKVVKPVEVADLDDDEDYYDDFYEEDEEEEEEEEEIMRAKKNQRPKSTPSKR
TKKKKKKQESPKSRRRLKVIAAVLILILCAQVFLAYKFLFAGGFGNKSLTVPNLVNMTLE
EAQSAVEKEGLYLSVKSEEYNSEVDENCIISQTPEGGSTNVKKGDTINVVVSKGSSQASV
PNVVGLTLSNAKQLIEENNLKVGTVKYEYSSIYKEGTVLSQSPGAGSSRAQEGDEVNLYV
SKGSEKSNTQTPTVPDKKPTTPENNTPTEPGSNSGNSGGNSGSSNSGNSGGNSGNNGGNS
GGSNSGNSGGSSGGSNSGDNGGSSGGSNSGDNGGSSGGSNSGDNGDSSGGSNSGDNGGTS
SGTGANIGKTE
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gtgggagatacaattttaggaaatcgatatgaaatcatcaggaagattggtgatggagga
atggcctttgtatatgaggctaaagacagattattaaacaggactgttgcacttaaagta
cttagacctgaatttgtagatgatgatgaatttctaacaaagtttaaaagagaggcagaa
gcagtagcaagtctttcacatccaaatatagtaaatgtttatgatgttggtgaagatgga
aaagttcactacattgtaatggagtttgtagatgggaagaatctaaaagagattatacaa
gatgaaggtatattagatgaatatactgcattagatataacaaaacaaatagctatggca
cttagtgcagcgcacaaaaaggggattatacatagagatataaaacctcataatattctc
atatcaaatgaaggaagagtagtaaaagtggctgattttggtatagccaaagctgtttca
aattcaacaatgactaatattggtagtataataggttcagtgcattatttttcaccagag
caagctaaaggtaaatttgtaactaataatgctgacctgtattctctaggtatagtttta
tatgaaatgttgataggaaaagttccatttaggggagatagtccaatttctatagcactt
caacacattaatgatgatatagactttacatcagaagaaaaagttaggattcctcaaagt
gtaagaactacaataaaaaagcttacagaaaaatctagcgcagatagatatcaaactgct
gaagaattgatagaagatatagagtatatagaaaaaaatattgatttagattttataaaa
gaatatgatgattttgcaactaagaaaattgatgaaaaagaaattaataaagttgtaaat
ccaacacttgcaaaaccagctcctgaaaaagtggttaagcctgttgaagtagctgatttg
gatgatgatgaagattactatgatgatttttatgaagaagatgaagaagaagaagaagaa
gaggaagagataatgagagctaaaaagaatcagagacctaagagtactccaagtaagaga
actaagaaaaagaagaaaaaacaggaaagcccaaaatctagaagaagattaaaagtaatt
gcggctgttttgatactgatattgtgtgctcaagtattcttagcatataagtttttattt
gctggagggtttggcaataaatctttgactgttcctaatcttgtaaatatgacattagaa
gaagctcaaagtgctgttgaaaaagaaggattatacctgagtgtaaaaagtgaagagtat
aatagtgaagttgatgaaaattgtataatatcacagacacctgaaggtggaagtacaaat
gtcaaaaagggtgatactataaatgttgtcgtaagtaaaggttcaagtcaggcatctgtt
cctaatgtggtgggacttactttgagtaatgcaaaacaacttattgaagaaaataactta
aaagtgggaactgttaagtatgaatatagctcaatatataaagaaggtacagttttaagt
cagagtccaggtgctggctcatcaagagctcaggaaggtgatgaggtaaacctatatgta
agcaaaggttcagaaaaatcaaatacacagactccaacagtaccagataaaaaaccaaca
acaccagagaataatacaccaacagaacctggttcaaactcagggaacagtggtggaaat
tcaggaagttcaaactcaggaaatagtggaggaaactcaggcaataatggaggtaactca
ggaggttcaaactcaggaaatagtggaggaagctcaggaggctcaaactcaggagataat
ggaggaagttcaggaggttcaaactcaggagataatggaggaagttcaggaggttcaaac
tcaggagacaatggagatagttcaggaggctcaaactcaggagataatggaggaacttca
tcaggaactggcgcaaacattggtaaaacagaataa

DBGET integrated database retrieval system