KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0420Help
Entry
CDCE8392_0420     CDS       T01700                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Brite
KEGG Orthology (KO) [BR:cdd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cdd03012]
    CDCE8392_0420 (tuf)
   03029 Mitochondrial biogenesis [BR:cdd03029]
    CDCE8392_0420 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdd04147]
    CDCE8392_0420 (tuf)
Translation factors [BR:cdd03012]
 Eukaryotic Type
  Elongation factors
   CDCE8392_0420 (tuf)
 Prokaryotic Type
   CDCE8392_0420 (tuf)
Mitochondrial biogenesis [BR:cdd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CDCE8392_0420 (tuf)
Exosome [BR:cdd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CDCE8392_0420 (tuf)
  Exosomal proteins of breast cancer cells
   CDCE8392_0420 (tuf)
  Exosomal proteins of colorectal cancer cells
   CDCE8392_0420 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEX71420
LinkDB All DBs
Position
415452..416642
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEEAPIIHISALKAL
EGDEKWTQSIIDLMQACDDSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGSLKV
NEDVEIIGIREKATTTTVTGIEMFRKLLDYTEAGDNCGLLLRGVKREDVERGQVVVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagttcgagcgtaccaagccgcacgtcaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgctgctatcaccaaggttttggcagacgcttac
ccagagctgaacgaagctttcgctttcgatgccatcgataaggcaccggaagagaaagag
cgtggtattaccatcaacatctcccacgtggagtaccagaccgagaagcgccactacgca
cacgttgacgctccaggtcacgctgactacatcaagaacatgatcaccggtgctgctcag
atggacggcgcaatcctcgttgttgctgccaccgacggcccaatgcctcagacccgtgag
cacgttctgctcgctcgccaggtcggcgttccttacatcctcgttgctctgaacaagtgc
gacatggttgatgatgaggaaatcatcgagctcgtcgagatggagatccgtgagctgctc
gctgagcaggattacgacgaagaggctccaatcatccacatctccgcactgaaggctctt
gagggcgacgagaagtggacccagtccatcatcgacctcatgcaggcttgcgatgattcc
atcccagacccagagcgtgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggccgcggtaccgttgttaccggccgtgttgagcgtggctccctgaaggtc
aacgaggacgtcgagatcatcggtatccgcgagaaggctaccaccaccaccgttaccggt
atcgagatgttccgtaagcttctcgactacaccgaggctggcgacaactgtggtctgctt
ctccgtggcgttaagcgcgaagacgttgagcgtggtcaggttgttgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttctgtccaaggacgagggtggc
cgccacaccccattcttcgacaactaccgcccacagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttcctgagggcaccgagatggtcatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggatgagggcctgcgcttcgctatccgc
gagggctcccgcaccgtcggcgctggtcgcgttaccaagatcatcaagtaa

DBGET integrated database retrieval system