KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2008Help
Entry
CDCE8392_2008     CDS       T01700                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00010  Glycolysis / Gluconeogenesis
cdd00071  Fatty acid degradation
cdd00350  Tyrosine metabolism
cdd00625  Chloroalkane and chloroalkene degradation
cdd00626  Naphthalene degradation
cdd01100  Metabolic pathways
cdd01110  Biosynthesis of secondary metabolites
cdd01120  Microbial metabolism in diverse environments
cdd01130  Biosynthesis of antibiotics
cdd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCE8392_2008 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDCE8392_2008 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CDCE8392_2008 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDCE8392_2008 (adhA)
   00626 Naphthalene degradation
    CDCE8392_2008 (adhA)
Enzymes [BR:cdd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDCE8392_2008 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short TrkA_N ThiF
Motif
Other DBs
NCBI-ProteinID: AEX72991
LinkDB All DBs
Position
complement(2116720..2117760)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPAEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcaccgccgctgttgtggacaagtttggctcc
gagctcaacatccacgacgttgaccttccagagccaggccaacaccaagcactggtcaag
gtgctcacctccggcatctgccacactgacctccacgccgccgaaggcgactggccagtc
aagccaaagccaccattcgtcccaggccacgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcatagcgttgcgctgggtgacatggtcggtaacgtctggctgtggtcagct
tgtggcgagtgtgaatactgccgcaccggctgggagactatgtgtgagaaagccgagtac
ggtggatacaccgtcgatggctctttcggtcagtatatgctggtagatactcgctactgt
gcccgcatcccagacggctgtgacctgctggaagtcgccccaattttgtgcgctggcgtg
accgtgtacaaaggactcaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctgggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaaaaagcatggcgctgagttt
gtggtcaatgctcgtgaagaagacccagctgaggcaattgtgaagtacaccaagggtggc
gcacacggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccagcaccg
attttcgacatcgtgttcaagggcctgaccatccgcggctccctcgtgggaacgcgccaa
gacctcgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacgga
cgcatggctatccgctactag

DBGET integrated database retrieval system