KEGG   Corynebacterium diphtheriae HC02: CDHC02_1032Help
Entry
CDHC02_1032       CDS       T01694                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00620  Pyruvate metabolism
cde00680  Methane metabolism
cde01100  Metabolic pathways
cde01120  Microbial metabolism in diverse environments
cde01200  Carbon metabolism
Module
cde_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDHC02_1032 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CDHC02_1032 (ppc)
Enzymes [BR:cde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CDHC02_1032 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase WbqC PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEX76524
LinkDB All DBs
Position
1077793..1080546
Genome map
AA seq 917 aa AA seqDB search
MGTLCIHHFCRKAELVTAAISDRVREDIRLLGRVLGRVIAQQEGEEVYELVEATRRMAFD
VSHGDADPEDLMVIFRDLDITKTNLVARAFSYFALLANLAEDLDDESVEADVSLRKTFAK
LKREGVSAADAASVIRSAEVAPVLTAYPTETRRRTVFDTQTRIKQLLKDAHHGGDMQVIE
QEMYLRMTLLWQTALIRIARPTLEDEIDVGLRYYKKSLLEQVPALNRSIRHSMRETFGLQ
LPDIAVMRPGSWIGGDHDGNPYVNARTLTYATRQAAKTVARYYVEQLGELERELSLSDRY
SSCSKELLALAEASGNNWESRVDEPYRRAVYGMRARMKSNVDALERPEKTAGRKSSKRTP
YATPDDFLRDLDVIDRSLRAHNDDVIADDRLARIRSAVTTFGFHLYTLDIRQNSESFEAV
IEEVFAAARRVPGGKRYSELAEAEKVELLIQELQTPRPLLFPGALEVEDAFSADTTKELG
IFLAAAQAVRDFGSRSIAHCIISMTATVSDILEPMVLLKEVGLRDVDVVPLFETIDDLRC
GAAILRELWSHPFYREHLRARGDIQEVMLGYSDSNKDGGYLQANWALYDAELGLVELCRE
HNIELRLAHGRGGAVGRGGGPTYDAILAQPKGAVSGSVRITEQGEVISAKYGAPETARRH
LEAFVSGALEASLLDTEPIADPDRAYAIMRDLAGFSGQRYQELVGDPGFIEYFTQSTPLH
EIGELNLGSRPAARKQTTAISDLRAIPWVLSWSQSRTNIPGWFGVGSAVSRFVSAVPEKD
RESRWQELRDLYATWPFFRSVMSNMAQVMAKAEISLARLYADLVDDTEVADRIYALIAEE
FVLTRRAYLAITGNEALVSENQRQARSLKRRYPYLLPLNAIQLELLRRYRGGDDQFLVSK
TIQVTMNGLATALRNAG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgggcacactttgtatccatcacttttgtaggaaggctgagctcgtgactgctgccatt
tctgatcgtgtccgtgaagatattcgattgctgggacgcgtactaggacgagttattgcg
cagcaagagggcgaagaagtctatgagctggtagaagctactagacgcatggcgtttgat
gtttctcatggtgacgctgatcctgaagacttaatggtgatctttagggatcttgatatc
actaagaccaaccttgttgctcgtgcttttagttattttgcgctgttggctaatttggct
gaggatctagacgatgaatccgtagaggcggatgtttcattgcgtaaaacttttgccaag
cttaagcgggagggggtgtctgcagctgatgctgcgagtgtgattcgtagtgctgaggtt
gcaccggtgcttacggcgtatcctacggagacgcgtcgtcgtacggtgtttgatactcag
actcggatcaagcagttgctcaaagacgcccatcatggtggggatatgcaggtcattgag
caggaaatgtatctgcggatgacgctcttgtggcaaaccgcgctgattcgtattgcgcgt
ccaacgctggaggatgagatcgatgtggggttgcgctattacaagaagtcactcttggag
caggttcctgcgttgaatcgttcgatccgtcattctatgagggagacgtttggtctgcag
ctgccagatattgcggtgatgcgtcctggctcgtggattggtggcgatcacgatggtaat
ccgtatgttaatgctcgtaccttgacgtacgcgacgcgtcaggccgccaagacagtggcg
cgttattacgtggagcagttgggtgaactggaacgcgagctgtcgctgtctgatcgttat
tcttcgtgctccaaggagctgcttgcgttggccgaggcttcgggtaacaactgggaatcg
cgtgttgatgagccgtatcgtcgtgcagtctatgggatgcgcgcccgtatgaagtccaat
gtggacgctttggagcgtccggagaaaacagcggggaggaagtcgtcgaaacgcacgcct
tatgcgacccctgatgacttccttcgcgatctcgatgtgattgatcgatcgttgcgtgcg
cacaacgatgatgtgatcgctgatgatcggctagcgcgtatccgctcggctgtaaccact
tttgggttccatttgtacactctcgatatccgtcagaattctgagtcttttgaggctgtg
atcgaggaggtattcgcggcagcgcgtcgtgtacccggcggtaagcgttattcggagctt
gctgaggcagaaaaggttgagctgcttatccaggagctgcaaactccgcgtccgctgttg
ttccccggcgcgcttgaggtcgaggatgcgtttagcgctgataccactaaggaattgggg
attttcttagcggcggctcaggcggtgcgggatttcggatcgcggtcaattgcgcattgc
attatttcgatgacggctacggtgtccgacattttggagcctatggtgcttttgaaggaa
gtcggattgcgtgatgttgatgtggttccgctttttgagactatcgacgatcttcgctgc
ggtgctgctattttgcgcgagctgtggtcgcatccgttttatcgtgagcatcttcgtgcc
cgtggggatatccaagaggtgatgttggggtattccgattccaacaaggacggcgggtat
ctgcaagctaactgggcgttgtatgatgctgagctgggcttggtggagttgtgccgtgag
cacaatattgagttgcgtttggctcatggccgtggtggcgctgtgggccgtggtggtgga
cctacttacgatgcgattttggcgcagccgaagggtgcggtgtcgggttctgttcgtatt
acggagcagggtgaggtgatttctgcgaagtatggtgcgcctgagacggcgcgccgtcac
ttggaggcgtttgtttcgggggcgttggaggcgtcgcttctcgatactgagccgattgcg
gatccggatcgtgcgtatgcgattatgcgtgatcttgctggctttagtggtcagaggtat
caggagttggtgggagatcctgggtttattgagtacttcacgcagtcgactccattgcat
gagattggtgagcttaatctggggtcgcgtcctgctgcgcgtaagcaaacgacagctatt
tcagatcttcgtgctattccgtgggtgttgtcgtggtcgcagtcgcggaccaatattcct
ggttggtttggtgttggtagcgcggtgagccgttttgtatcggcggtgccggagaaggac
cgagagtcacggtggcaggagctgcgtgatttgtatgcaacgtggccatttttccgctcg
gtgatgtcaaatatggctcaggttatggccaaggcagagatttcgctggcaaggttgtat
gccgatttggtggatgataccgaggttgctgaccggatttatgcgttgatcgcggaggag
tttgtacttacgcgtcgtgcgtacttggctattactggtaatgaggcgctggtgtcggaa
aaccagcgccaagcccgttcgctcaagcggcgttacccgtatttgctaccgcttaacgcc
attcagctggagttactgcggcgttatcgtggtggcgatgatcaattcttggtgtctaag
actattcaggtcaccatgaatggtttggccactgcgttgcgtaatgcggggtag

DBGET integrated database retrieval system