KEGG   Corynebacterium diphtheriae HC02: CDHC02_1500Help
Entry
CDHC02_1500       CDS       T01694                                 

Gene name
pknL
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cde  Corynebacterium diphtheriae HC02
Brite
KEGG Orthology (KO) [BR:cde00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cde01001]
    CDHC02_1500 (pknL)
Enzymes [BR:cde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDHC02_1500 (pknL)
Protein kinases [BR:cde01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDHC02_1500 (pknL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: AEX76989
LinkDB All DBs
Position
1611986..1614178
Genome map
AA seq 730 aa AA seqDB search
MADLKIGDVLENRYRIEAPIARGGMSTVYRCVDTRLGRLVAAKVMDQRYLDDPIFKDRFR
REARSMAQLSHPCLVGVYDFSSDGDNIFLIMELITGGTLRELLAERGPMPPHAAVAVMRS
VLTGLSVAHSAGMVHRDIKPDNVLINADHQVKLADFGLVRAASASQATSNQIVGTVSYLS
PEQVSGDDIGPESDVYSAGIVMFELLTGTTPFSGDNQIAHAYARLDSAVPAPSSMIAGIP
PLIDALVASATALRPEERFADAAEFLNALDDVAQELRLPEFRVPVPANAAAYRSNEHLTG
HFTTSDLMTTDLPRETEGLFPIEDASTHTRAFQPITPQPATPVGPVAQRKPDYSPEPVAP
QHAPAATHEPVTNRSKISFVLWLIAVITLATAVALGAWWFGSGRYGEVPQVLGLDQVQAV
AVTEESGFGAVTEPVYSDDVPKNAIAGTKPDQGQRAVKGDDITLLVSQGRPTVPDVPQSR
SASEYRRLLEERTLEYRESAPEFSDSVPEGKIARVVPGSGNEVAVGGAVSVALSQGPAPV
TIPNVSERPVDQARNELEKLGFDVTIAKEFSDTIPGGDAIGTDPAAGTTLPRGSSVTLKV
STSVEIPDVRGKSRHAAISALADAGITVESISRSDNEVGNSADEVTSITPSSGNLIDPAH
TKVSLILAGRVEVPSVVGKRYAEAKRELEAAGFSVTTSGTSKSSARVYWQTPAGGRAEPG
ATIKLKTLSS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcagatctgaaaatcggcgacgtgctagaaaaccgttatcgcatcgaggctcctatt
gctaggggtgggatgtcaacggtctaccggtgtgtggatacccgcttgggtcggcttgtc
gctgcgaaggtaatggatcagcgttatctggacgacccgattttcaaagaccgcttccgt
agggaagctcgctccatggcccagttgagtcacccatgtttggtgggagtctatgacttt
tcttccgatggcgacaacatcttcctcattatggagctgatcaccggcggcactttgcgc
gagcttttggccgaacgcgggcctatgcctcctcatgcagcggtcgccgtcatgcgttcg
gttctgactggtttgtccgtagcccactcggcgggcatggttcatcgcgatatcaaaccc
gacaatgtgctaatcaacgccgatcatcaggtgaagttggcggactttggtttggtgcgg
gcggcgtcggctagccaagcgacttccaatcaaatcgtcggcacggtgtcttatctctcc
cctgagcaagtttctggcgatgacatcggccccgaaagcgatgtgtactccgccggcatc
gtgatgttcgagttactcaccggcaccactccgtttagcggcgacaatcaaattgcgcat
gcttacgcgcgtctcgatagtgcagtgccagcaccttcatccatgatcgcaggaattcca
ccgcttatcgacgccctcgttgcttctgctacagcgctacgccccgaagaacgcttcgcc
gatgcagcagagtttctcaatgcgctagacgacgtagctcaagaactacgtctcccagaa
ttcagagtgccagtacctgccaatgctgcagcttatcgttccaatgaacatctcactggc
catttcacaacgtccgacctcatgactacggacctgccgagagaaactgaaggcctgttc
cctatcgaagacgccagcactcatactcgcgccttccaaccaattacgccacagcctgct
acccccgtcgggcctgttgcacaacgaaaaccagactattctcctgaaccagtagcacca
caacatgccccagctgcaacgcatgagcccgtcaccaatcgctccaaaatcagttttgtt
ttgtggctcatagctgtcattaccctagccactgcggtagcccttggcgcatggtggttt
ggttctggacgctacggtgaagtcccccaggttcttggcctcgaccaagtacaagccgta
gccgttaccgaggaatccggctttggcgcagtcaccgagcctgtatatagcgacgacgtt
cctaaaaatgccatcgctggcacgaaaccagaccagggccaacgtgctgtgaaaggtgac
gacatcacgttgctggtatcccaaggacgcccgaccgttcccgatgttcctcaaagtcgt
tcagcttccgagtaccgtcgcttgctcgaagagcgcacacttgagtaccgcgaaagcgcc
cccgaattttctgattccgtgcccgaaggaaaaatcgcccgtgttgtaccaggttcgggc
aacgaagtcgcagtcggcggtgccgtatcagttgcactttcccaaggtccagcgcctgta
accatccccaatgtttctgaacgtcccgttgatcaagcgcgaaacgagctggaaaaacta
ggattcgacgtcaccatcgccaaagaatttagtgacaccatccctggcggtgacgcaatc
ggtaccgaccccgcagcaggcactactctcccccgcggcagctcagtaactcttaaagtt
tctacctctgtagaaattcctgatgttcgtggaaaatcgcgccatgctgccatcagcgct
cttgctgatgcaggtattaccgtggagtcgatttctcgttccgataatgaggtaggcaat
tctgcagacgaggtcacatcgattacaccaagttctggtaatctcatcgatcctgcacat
accaaagtctcgttgattcttgcgggcagagtcgaagtgccttctgttgtaggtaaacgc
tacgctgaggctaaacgcgaactagaggcagcaggctttagcgtgaccacaagcgggacg
agcaagtcttctgcacgagtgtattggcagactcctgccggtggacgcgctgaaccaggg
gctaccatcaaactcaaaaccctgagctcttag

DBGET integrated database retrieval system