KEGG   Clostridioides difficile 630: CD630_00380Help
Entry
CD630_00380       CDS       T00487                                 

Gene name
acoC
Definition
(RefSeq) acetoin dehydrogenase E2 component dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00010  Glycolysis / Gluconeogenesis
cdf00020  Citrate cycle (TCA cycle)
cdf00620  Pyruvate metabolism
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
cdf01200  Carbon metabolism
Module
cdf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_00380 (acoC)
   00020 Citrate cycle (TCA cycle)
    CD630_00380 (acoC)
   00620 Pyruvate metabolism
    CD630_00380 (acoC)
Enzymes [BR:cdf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CD630_00380 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CAT
Motif
Other DBs
NCBI-GeneID: 4916626
NCBI-ProteinID: YP_001086501
UniProt: Q18CC2
LinkDB All DBs
Position
60446..61492
Genome map
AA seq 348 aa AA seqDB search
MVANKIKATPAARSQARKDNIKLDRLIGSGENGRIHLVDVLNYLKDNKANTTPLARRIAE
DLNIDLETIVGTGYNGKIRKCDVEKLTAKETIVSTNTSKSSEKKELKIENENSSMFNTVE
GIFEKPNPMRATVAKRMSESYFSAPVFTFNIEVDATELKVLRAKLIDTVKESTGVKLTMT
DLIVMAVSKILPNHQALNSAWTDEGIFRYKDVNIAIAVGLDEGLYVPVVKNANKKSLKEI
AKESKELAEKVKTGKLMPADQEGNTFTISNVGMYGITTFTPIINMPSSAILGVGATQDKF
VPVNGEAKIKPIMNLSLTSDHRVIDGTVAAKFLKDLKELLENPLSMLV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaaataaaataaaagccacaccagcagctagaagtcaggcaagaaaagacaat
ataaaattagataggctgattggaagtggagaaaatggaaggattcatttagtagatgtg
ttaaattatttaaaagataataaagcaaatactactcctttagctagaagaatagcagaa
gatttaaatatagatttagaaactattgtaggtactggatataatggaaagataagaaag
tgtgatgtggaaaaattaactgcaaaagaaactattgtatcaactaatacatctaaatct
agtgagaaaaaagagctgaaaattgaaaatgaaaattcaagcatgtttaacacagtagaa
ggaatatttgaaaagccaaatccaatgagagctactgtagcaaaacgaatgtcagaaagt
tattttagtgctcctgtatttacattcaatatagaagtagatgctacagaattgaaggta
cttagagcaaagttaatcgacacagtaaaagaatcaactggagtaaaattaactatgaca
gatttaatagtaatggcagtatctaaaatacttccaaatcatcaagccttaaattcagca
tggacagatgagggtatatttagatataaagatgtaaatatagctattgcagttggttta
gatgaaggcttatatgttccggtagtaaaaaatgcaaacaaaaagtctttaaaagaaata
gcaaaagaaagcaaagaacttgcggaaaaagtaaagacagggaaacttatgccagcagac
caagaaggtaatacatttacaataagtaatgttggaatgtatggtataactacatttaca
cctataataaatatgccttcaagtgcaatcttaggggtaggtgctacacaagataagttt
gttccagtaaatggagaggctaaaataaaacctataatgaacttatcattaacatcagac
catagagtaatagatggaacagtagctgcaaaattcttaaaagatttaaaagaattgtta
gaaaatcctttatcaatgcttgtatag

DBGET integrated database retrieval system