KEGG   Clostridioides difficile 630: CD630_02930Help
Entry
CD630_02930       CDS       T00487                                 

Definition
(RefSeq) bacitracin/multidrug family ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
cdf  Clostridioides difficile 630
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdf02000]
    CD630_02930
Transporters [BR:cdf02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    CD630_02930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 MukB AAA_23 AAA_30 AAA_22
Motif
Other DBs
NCBI-GeneID: 4913618
NCBI-ProteinID: YP_001086762
UniProt: Q18D31
LinkDB All DBs
Position
354353..355270
Genome map
AA seq 305 aa AA seqDB search
MNIVSINGLSKGFGNRKIIDNLNFTVPEGSVFGFVGKNGAGKTTTMKMVLGLLEPDSGTI
DVCGEKVTYGRTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEITGLSKKEIQIRSEELLS
LVGLGNEKRRIGGFSRGMKQRLGIAQALLSRPKLLICDEPTSALDPVGRKEILDIMLKIK
DSTTVIFSTHILSDVERICDHVAILNKGSIALSGTLSEIKSMHGKDRLLLEFASNDEIQK
FKSSDGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLAEMNLCPVKMELIELSLENLF
LEVVK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgtctcaataaatggattatcaaaaggttttggtaatcgaaagataatagat
aatttaaattttactgtaccagaagggtcagtctttgggtttgtaggtaagaatggtgca
ggtaagactacaacaatgaaaatggtacttgggttacttgaaccagatagtggaactata
gatgtttgtggtgagaaagtgacctatggaagaacaagttctaatcgtcatgtaggttat
ctgcctgatgttccagagttttacaactatatgagaccacttgaatatctttctctttgt
ggtgaaattacgggactttcaaaaaaagaaatacagataaggagtgaagagttgttatca
cttgtgggtcttggaaatgaaaagagacgaataggtgggttttctcgtggaatgaagcaa
cgacttggtatagcccaagctttgctttcacgccccaaattacttatttgtgatgaacca
acaagtgcacttgaccctgttggtcgaaaagaaatattagatattatgcttaaaatcaaa
gactcaacaactgtaatattttcaacacatatactatcagatgttgaaagaatctgtgac
catgttgctatattaaacaaaggaagcattgcccttagtggtacactttcagaaataaaa
agtatgcacggaaaggatagacttttactggagtttgcaagtaatgatgaaattcaaaag
tttaagtctagtgatggtattaaatccttactaaaagattcagaagaaactaatatggaa
attgttttgcatggtaaagatataaaagcaatacaaaaaacagttatatctacactcgca
gaaatgaatctttgtccagtaaagatggaactaatagaattatcacttgaaaatttattt
ttggaggtagtaaagtga

DBGET integrated database retrieval system