KEGG   Clostridioides difficile 630: CD630_25780Help
Entry
CD630_25780       CDS       T00487                                 

Definition
(RefSeq) serine/threonine-protein kinase and phosphatase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdf  Clostridioides difficile 630
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdf01001]
    CD630_25780
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CD630_25780
Protein kinases [BR:cdf01001]
 Serine/threonine kinases: Other
  Bacterial family
   CD630_25780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo YL1 Kinase-like RIO1 Pkinase_fungal CDC45 Fructosamin_kin VKG_Carbox
Motif
Other DBs
NCBI-GeneID: 4914699
NCBI-ProteinID: YP_001089094
UniProt: Q182R7
LinkDB All DBs
Position
complement(2981778..2983787)
Genome map
AA seq 669 aa AA seqDB search
MGDTILGNRYEIIRKIGDGGMAFVYEAKDRLLNRTVALKVLRPEFVDDDEFLTKFKREAE
AVASLSHPNIVNVYDVGEDGKVHYIVMEFVDGKNLKEIIQDEGILDEYTALDITKQIAMA
LSAAHKKGIIHRDIKPHNILISNEGRVVKVADFGIAKAVSNSTMTNIGSIIGSVHYFSPE
QAKGKFVTNNADLYSLGIVLYEMLIGKVPFRGDSPISIALQHINDDIDFTSEEKVRIPQS
VRTTIKKLTEKSSADRYQTAEELIEDIEYIEKNIDLDFIKEYDDFATKKIDEKEINKVVN
PTLAKPAPEKVVKPVEVADLDDDEDYYDDFYEEDDDEEEEEIMRAKKNQRPKSTPSKRTK
KKKKKQESPKSRRRLKVIAAVLILILCAQVFLAYKFLFAGGFGNKSLTVPNLVNMTLEEA
QSAVEKEGLYLSVKSEEYNSEVDENCIISQTPEGGSTNVKKGDTINVVVSKGSSQASVPN
VVGLTLSNAKQLIEENNLKVGTVKYEYSSIYKEGTVLSQSPGAGSSRAQEGDEVNLYVSK
GSEKSNTQTPTVPDKKPTTPENNTPTEPGSNSGNSGGNSGGSNSGNSGGNSGNNGSNSGG
SNSGNSGGNSGGSNSGDNGGSSGGSNSGDNGGSSGGSNSGDNGDSSGGSNSGDNGGTSSG
TGANIGKTE
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
gtgggagatacaattttaggaaatcgatatgaaatcatcaggaagattggtgatggagga
atggcctttgtatatgaggctaaagacagattattaaacaggactgttgcacttaaagta
cttagacctgaatttgtagatgatgatgaatttctaacaaagtttaaaagagaggcagaa
gcagtagcaagtctttcacatccaaatatagtaaatgtttatgatgttggtgaagatgga
aaagttcactacattgtaatggagtttgtagatgggaagaatctaaaagagattatacaa
gatgaaggtatattagatgaatatactgcattagatataacaaaacaaatagctatggca
cttagtgcagcgcacaaaaaggggattatacatagagatataaaacctcataatattctc
atatcaaatgaaggaagagtagtaaaagtggctgattttggtatagccaaagctgtttca
aattcaacaatgactaatattggtagtataataggttcagtgcattatttttcaccagag
caagctaaaggtaaatttgtaactaataatgctgacctgtattctctaggtatagtttta
tatgaaatgttgataggaaaagttccatttaggggagatagtccaatttctatagcactt
caacacattaatgatgatatagactttacatcagaagaaaaagttaggattcctcaaagt
gtaagaactacgataaaaaagcttacagaaaaatctagtgcagatagatatcaaactgct
gaagaattgatagaagatatagagtatatagaaaaaaatattgatttagattttataaaa
gaatatgatgattttgcaactaagaaaattgatgaaaaagaaattaataaagttgtaaat
ccaacacttgcaaaaccagctcctgaaaaagtggttaagcctgttgaagtagctgatttg
gatgatgatgaagattactatgatgatttttatgaagaagatgatgatgaagaagaggaa
gagataatgagagctaaaaagaatcagagacctaagagtactccaagtaagagaactaag
aaaaagaagaaaaaacaggaaagcccaaaatctagaagaagattaaaagtaattgcggct
gttttgatactgatattgtgtgctcaagtattcttagcatataagtttttatttgctgga
gggtttggcaataaatctttgactgttcctaatcttgtaaatatgacattagaagaagct
caaagtgctgttgaaaaagaaggattatacctgagtgtaaaaagtgaagagtataatagt
gaagttgatgaaaattgtataatatcacagacacctgaaggtggaagtacaaatgtcaaa
aagggtgatactataaatgttgtcgtaagtaaaggttcaagtcaggcatctgttcctaat
gtagtgggacttactttgagtaatgcaaaacaacttattgaagaaaataacttaaaagtg
ggaactgttaagtatgaatacagctcaatatataaagaaggtacagttttaagtcagagt
ccgggtgctggctcatcaagagctcaggaaggtgatgaggtaaacctatatgtaagcaaa
ggttcagaaaaatcaaatacacagactccaacagtaccagataaaaaaccaacaacacca
gagaataatacaccaacagaacctggttcaaactcaggaaacagtggtggaaattcagga
ggctcaaattcaggaaatagtggtggaaactcaggcaataatggaagtaactcaggaggt
tcaaactcaggaaatagtggtggaaactcaggaggctcaaactcaggagataatggagga
agttcaggaggctcaaactcaggagacaatggaggaagttcaggaggttcaaactcagga
gacaatggagatagttcaggaggctcaaactcaggagataatggaggaacttcatcagga
actggcgcaaacattggtaaaacagaataa

DBGET integrated database retrieval system