KEGG   Clostridioides difficile 630: CD630_34630Help
Entry
CD630_34630       CDS       T00487                                 

Gene name
alr2
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00473  D-Alanine metabolism
cdf01100  Metabolic pathways
cdf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CD630_34630 (alr2)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CD630_34630 (alr2)
Enzymes [BR:cdf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CD630_34630 (alr2)
Peptidoglycan biosynthesis and degradation proteins [BR:cdf01011]
 Precursor biosynthesis
  Racemase
   CD630_34630 (alr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 4914797
NCBI-ProteinID: YP_001089983
UniProt: Q180W0
LinkDB All DBs
Structure
PDB: 

Position
complement(4055543..4056700)
Genome map
AA seq 385 aa AA seqDB search
MQKITVPTWAEINLDNLRFNLNNIKNLLEEDIKICGVIKADAYGHGAVEVAKLLEKEKVD
YLAVARTAEGIELRQNGITLPILNLGYTPDEAFEDSIKNKITMTVYSLETAQKINEIAKS
LGEKACVHVKIDSGMTRIGFQPNEESVQEIIELNKLEYIDLEGMFTHFATADEVSKEYTY
KQANNYKFMSDKLDEAGVKIAIKHVSNSAAIMDCPDLRLNMVRAGIILYGHYPSDDVFKD
RLELRPAMKLKSKIGHIKQVEPGVGISYGLKYTTTGKETIATVPIGYADGFTRIQKNPKV
LIKGEVFDVVGRICMDQIMVRIDKDIDIKVGDEVILFGEGEVTAERIAKDLGTINYEVLC
MISRRVDRVYMENNELVQINSYLLK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaataacagtgcctacatgggcagagataaatctagataacttaagatttaac
ttaaataatattaaaaatttattagaagaagatattaagatttgtggagtaataaaagct
gatgcatatggacatggtgcagtagaagttgcaaaattgctagaaaaagaaaaagtagat
tacttagcagtagcaagaactgctgaaggaattgaacttagacaaaatggcataacactt
cctattttgaacttgggatatactccagacgaagcttttgaagattctataaaaaataaa
ataactatgacagtttattctttagaaacagcacaaaagataaatgaaattgcaaaatct
ttaggagaaaaagcctgtgttcatgttaaaatagactcagggatgactagaataggtttc
caacctaatgaggagtcagtacaggaaataatagaattaaataaattagaatatatagat
ttagaaggtatgtttactcattttgctacagctgatgaagtaagtaaagagtacacttat
aaacaagctaataattataaatttatgtctgataaattagatgaggctggtgtaaaaata
gctataaaacatgtatcaaacagtgcagctattatggattgccctgatttaagattaaat
atggtaagagcaggaataatattatatggtcattatccatctgatgatgtatttaaagat
agattagaattaagaccagccatgaaattaaaatcaaaaatcggacatataaaacaagtt
gaaccaggtgtaggaataagttatggactaaaatacacaactacaggtaaagaaacaata
gctacagttccaataggatacgcagatggatttactagaatccaaaaaaatccaaaggtt
cttattaagggagaagtgtttgatgtagttggtagaatatgtatggatcaaataatggtt
agaattgacaaagatatagacataaaagttggagatgaggttatactatttggagaaggc
gaagttacagctgagcgtatagctaaagacttaggaactataaactatgaagtgttatgt
atgatatcaagaagagttgaccgtgtttatatggaaaataatgagcttgtacaaataaac
agttatttgctaaaataa

DBGET integrated database retrieval system