KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0043Help
Entry
CDB402_0043       CDS       T01688                                 

Gene name
pknB
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdh01001]
    CDB402_0043 (pknB)
Enzymes [BR:cdh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDB402_0043 (pknB)
Protein kinases [BR:cdh01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDB402_0043 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal RIO1 Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: AEX45355
LinkDB All DBs
Position
complement(47009..49030)
Genome map
AA seq 673 aa AA seqDB search
MTDIVLADRYRLGDVIGTGGMSEVYEATDVLLGRKVAVKMLRADLARDVNFRERFRREAQ
NSGKLNHPAIVAVYDTGETPRAGLNTPYIVMELVNGRTLRDIVCEDGPLTPSQAAHTLIP
VCHALQVSHDAGIIHRDIKPANVMITNTGAVKIMDFGIARALDDATSAMTQTSAVIGTAQ
YLSPEQARGKLADARSDVYALGCVLYETLTGKPPFEGETPFAVAYQHVQEDPVKPSEYIA
DLSPTAAINVDAVVLTAMAKHPGDRYQTAQEMCADLERLERNAVTDAARHYVTPTSFATQ
DPASTTVVPVTQVAELDHAEAGAGIGAGAVPAGAVAGSAAVSGSGGAHAAPRSSNRGLRI
LAAILTVLVLAVGAGFAIDYFGGGPFSQRSTVSIPKLQNSTQQDAVSQLEKLGLQVNVIE
EPNPDIPRGKVIRTNPTDGSNVQRNSTVRLTISSGKEITEVPDLSGKNTADAVKILEAAG
LLLDPTVREDSSDTVPKGEIIEVSPAAGSQVSRGSKVSITVSTGVETVRVPVITGMKWDQ
AEGNLTSLGFKPEVVRVDSVEPAGTVVAVPDEGAEVPKGSSVTVQISNGAMFTVPEITRQ
TIGDAVRILHDAGWKGNASRLIQAAKVPTVAVTDQNLIASQLPTPGTALRKDAPIEIRLY
EFNLAALVPPAQH
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatatcgttctcgccgaccgctatcgccttggtgacgtcatcggtactggtggc
atgtctgaggtgtatgaggccaccgatgttcttctcggccgcaaggtcgcggtaaaaatg
ctgcgtgccgacttggcacgggatgtgaacttccgcgagcgcttccgcagggaggcccaa
aactccggcaagctcaaccaccctgcgatcgtcgcggtgtacgacaccggtgaaactcca
cgggctgggttgaacactccttacattgtgatggagctggtcaacggccgtaccctgcgt
gacattgtttgtgaggatggtccgctaacacctagccaggcggcacatactttgatccct
gtgtgccatgcgctgcaggtcagccacgatgctggcattatccaccgcgacatcaaaccc
gctaacgtgatgatcaccaacaccggcgcggtcaaaatcatggactttggtatcgcacgc
gcgcttgacgacgccaccagcgccatgacgcagacctccgcagtgatcggcaccgcccag
tacctctcaccagagcaggcacgcggaaagcttgccgacgcccgctccgatgtctatgcc
ctaggctgtgtgctttatgaaaccctcactggtaaaccacctttcgagggtgaaaccccc
ttcgctgttgcgtaccaacacgtacaagaagaccctgtaaagcccagcgaatacatcgct
gacctctcgcctaccgcagcaattaacgtcgatgctgttgtgcttactgccatggctaag
caccctggggatcgctaccagaccgcacaagaaatgtgcgcggatcttgaacgccttgag
cgcaatgcggtcactgacgcggcacgccactatgtcaccccgaccagctttgctacccaa
gacccagcgtctaccaccgtggttccagtaacccaggtggctgagttggatcacgccgag
gctggtgctggcattggtgctggtgcggttcctgccggtgccgtagctggttcggctgcg
gtgtccggttccggtggtgcgcatgctgcaccacgatcatccaaccgtggcctgcggatt
ctcgccgctattttgacggtactcgttttggctgtaggtgccggctttgccattgactat
tttggtggcggaccgttttctcagcgatccaccgtgagcatccctaagctgcaaaactcc
acgcagcaggatgctgtgagccagctggaaaagctagggttacaggtcaatgtgatcgaa
gaacccaaccctgatattcctcgcggcaaggttattcgcaccaaccccaccgatggttcc
aacgtgcaacgcaactccaccgtgcgccttaccatctcctccggtaaagagatcactgag
gttcccgacctcagcggtaagaacaccgccgacgcggttaagatcctcgaagccgcaggt
ctgcttctcgaccccaccgtgcgtgaagactcctccgacaccgtgcccaagggcgaaatc
atcgaagtctcccccgcagccggatcccaagtatcccgtgggtccaaggtatccattact
gtctccaccggtgtagaaacagtccgcgttcccgtgatcaccggcatgaaatgggaccaa
gccgaaggcaacctgacctccctaggtttcaaacccgaagtcgtccgcgttgattccgtc
gaaccagccggaaccgtggtcgccgtaccagacgaaggcgccgaagtacccaagggttct
agcgtcaccgtgcagatctccaacggggcaatgttcaccgtcccagagatcacccgccaa
acgattggcgacgcagtgcgcatcctgcacgacgctggctggaaaggcaacgcctcccga
ctcatccaagcagcgaaagtgccgaccgtagccgtgaccgaccaaaacctgatcgcctca
caactaccaaccccaggcacagcactgcgcaaagacgcacccattgaaattcgcctctac
gaattcaaccttgcggcactcgtgccaccagcacagcactag

DBGET integrated database retrieval system