KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0044Help
Entry
CDB402_0044       CDS       T01688                                 

Gene name
pknA
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdh01001]
    CDB402_0044 (pknA)
Enzymes [BR:cdh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDB402_0044 (pknA)
Protein kinases [BR:cdh01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDB402_0044 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal WaaY RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AEX45356
LinkDB All DBs
Position
complement(49027..50535)
Genome map
AA seq 502 aa AA seqDB search
MTQSQSPDPALQALVGSDYALQWVVGNGGMSTVWLADDLRNQREVAIKVLRPEFSDNEEF
LSRFRNEALASEHIDSDNVVRTYDYREVTDDMGRTLCFIVMEYVRGESLADMLARKGRLE
EDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGQVKITDFGIAKAAAAVPLTRT
GMVVGTAQYVSPEQAQGRDVTAATDVYSLGVVGYEMLVGQRPFTGDSSVSVAIAHINQAP
PAMPTSVSAPARELIGIALRKDPAHRYADGNELALAVSATRMGQRPPQPKSAPLQHIAPQ
PAPTESTYALGATAQPTTVIPATGQVPAAPAAAAAYPASTVIPAGTPRQEPEKQSSGWGA
GIVVGALAALLLGTAAWAASQGMFDDLFDKTSQSSESSVPPPPVTATVTETPTPQITTVV
PEPLPTSRPEPTPSETERTPDESDPTLDHQLPSVRPSHNGRPSTQAPHSPTQDADKPAES
PAPDTLDSLIENLNKLNQGGAQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatcacagtcacctgatccggcactgcaggcactcgtcggttccgactacgcc
ctgcaatgggtggtgggcaacggtggaatgtccacggtttggcttgccgacgacctccgc
aaccagcgcgaagtggccatcaaggtgttgcgcccagaattctccgacaacgaagaattc
ctctcacgcttccgcaacgaggcactcgccagcgagcacatcgactccgacaacgtggtg
cgcacttacgactaccgcgaagtcaccgacgacatgggccgcaccctgtgcttcatcgtg
atggaatacgtccgcggcgaatccctcgccgacatgctggcacgcaaaggtcgcctcgaa
gaagaccttgctctcgacgttctcgagcaggcagcccacgggctatccatcatccatcgc
atgggtatggtccaccgcgacatcaaacctggcaaccttttgatcactcaaaacggccaa
gtaaaaattactgacttcggtatcgccaaagcagccgcagcagtaccactgacgcgaacg
ggcatggtggtgggcaccgcccagtatgtctccccagagcaggcacagggccgcgatgtt
accgcagctaccgacgtctactccctaggcgttgtgggatacgagatgctggtgggtcag
cgcccctttaccggcgactcctcggtttctgtggctatcgcccacatcaaccaagcccca
ccagccatgcccactagtgtgtccgccccggcgcgcgagctgatcggcattgcgctgcgc
aaggatccggcacaccgttatgccgatggcaacgagctggcgttggcggtttctgctacc
cgtatggggcagcgcccgccacagccaaagtcggcacccttgcagcatattgcgccgcag
ccggctcccacggaatccacctatgcgttgggcgctactgcgcaaccgacgacggttatt
ccggctaccggccaggtgcctgctgctcccgctgctgctgccgcgtatccggcatcgacg
gtgattcctgctggcacgccacgccaggagccggagaagcagtctagtggttggggtgcc
ggcattgtggttggcgcgttggctgcattgttgttgggtactgctgcgtgggctgcaagt
cagggcatgtttgatgatctttttgataagacgtcgcaaagctcggagtcctcggttccg
ccgccacctgtgacggctaccgtgacggagactcctacaccgcagatcactactgtggtc
ccagagccgttgcctacgtcgcgcccggagccaactccgagtgaaacggagcgtactcct
gacgagtcggacccaacgttggatcaccagttgccttcggtgcgcccgtcgcataatggt
cgccccagcacgcaagcgccacattcgcctacgcaggatgctgataagcctgccgaatca
cctgctcccgatactctcgattctttgatcgagaatctgaacaagctcaaccaaggaggt
gcccagtga

DBGET integrated database retrieval system