KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0442Help
Entry
CDB402_0442       CDS       T01688                                 

Definition
(GenBank) putative glycosilase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00500  Starch and sucrose metabolism
cdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDB402_0442
Enzymes [BR:cdh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CDB402_0442
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CDB402_0442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AEX45753
LinkDB All DBs
Position
complement(461859..463601)
Genome map
AA seq 580 aa AA seqDB search
MDINRALARNEPIRRYFYPHTTTPTTPLVITSYLTPKNTSRELSTIESMTSKSLPTRTTL
SSGTFYQIYPPSFADSNKDGIGDFRGIISRLDYLSDLGITGIWLNACFDSPFKDGGYDVR
DYTKVASRYGTHEDLVELFHQAHARGIAIILDLVPGHTSEQHPWFQQSAASKYTDFDDRY
IWTSHAFEGGAGLAFIGGEHPRNGAYIINFFKSQPALNYGFAELTQPWHQPVDAPGPRAN
QDAMVEIMKYWLSQGADGFRVDMADSLVKNDDTSKRATIGIWQSMLSQVRAEFPNAIFVS
EWGTPTQAFEAGFDADFYLDWRGNGYNLLARNTDTPLERRDDASFFNSDSATGAQEFLDM
YLPQWERTHEAGLFSFISGNHDCPRLAPRLNEQERALFFLFQLTMPGLPFIYYGDEIGLP
YAEIPTKEGGYARTGSRTPMCWDSQLPNGGFSLGDAPLYLPMTNTSQNVAQQRERADSLF
HHVQKLIQLRSQLPALDGFADLEFDLSLLKKHPKVMVYRRTHHHGDSVLIALNAGNKPIR
VELQQPQAHELFRCGDVTYPDLSDHSVVELGPTSGVILSV
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggatattaacagagccttagctagaaatgaaccaattcgcagatatttttatccccac
accactacccccactaccccactggtaataacctcatacctcacaccgaaaaacacctcg
cgtgagctcagtacgatagagagcatgacgtcgaaaagccttccaactcgcaccacgcta
agctcgggaacgttctatcagatttaccctcctagctttgccgattccaataaagacggc
atcggagatttccgtggaatcatctcgcgactcgactatctcagcgaccttggcatcacc
ggaatctggctcaacgcgtgctttgattcaccttttaaagacggcggctacgatgtgcgc
gactacacaaaggtggcttctcggtacggcacccatgaggatttggtggagcttttccac
caagcgcatgcccgcggaattgccattatcttggatctggttcctggtcacaccagcgaa
caacacccttggtttcaacaaagtgctgctagtaaatacacagattttgatgaccgctat
atttggacttcgcacgcatttgagggtggtgcggggctagcttttattggcggcgaacac
ccccgcaacggtgcgtacattattaatttcttcaaatctcaacctgcactcaattatggt
ttcgcagaattaacccagccatggcaccaaccagtagatgcccctggcccgcgggcaaat
caagacgcgatggttgagattatgaagtactggttatcgcaaggtgccgatggtttccgc
gtggatatggcggattcgcttgtgaaaaacgacgacacctcaaagcgggccacgattggt
atttggcagtctatgttgagccaagttcgcgccgagtttcctaatgccatctttgtctcg
gagtggggcacgcctactcaagcgtttgaggcgggctttgacgctgacttttacctcgat
tggcgcggtaatggttacaaccttttggcacgtaacacggataccccactggagcggcgc
gatgatgcaagtttctttaactctgattccgctacgggcgcccaagagtttctcgatatg
tatttgccgcaatgggagcgcacccatgaggcagggctgtttagttttatcagcggtaac
catgactgcccgcgtcttgcaccacgcctgaatgaacaagaacgcgcgttgttcttcttg
ttccagctcactatgcctggccttcctttcatttattacggggatgaaattgggcttccc
tatgcggagatccctacgaaggagggcggctatgcgcgcacggggtcgcgcacccccatg
tgttgggattcccagttgcctaacggcggtttttcgcttggcgacgctcccctgtacctc
cccatgactaatacatcccagaatgtggcgcagcagcgtgagcgtgcggattcgttgttc
catcacgtacaaaagctcattcagttgcgttctcagctgccagctttagatggctttgct
gatctagagtttgatctttctctcctaaagaagcaccccaaggttatggtgtatcgccgc
actcatcatcatggcgacagcgtgcttattgccctcaatgcaggtaacaagccgatacgc
gtcgagcttcagcagccccaagcacatgagcttttccgttgtggtgatgtgacatatccc
gatctctcagatcacagcgtggttgagttgggtcctacttctggcgtcatcttgtccgtg
taa

DBGET integrated database retrieval system