KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1315Help
Entry
CDB402_1315       CDS       T01688                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00010  Glycolysis / Gluconeogenesis
cdh00520  Amino sugar and nucleotide sugar metabolism
cdh01100  Metabolic pathways
cdh01110  Biosynthesis of secondary metabolites
cdh01120  Microbial metabolism in diverse environments
cdh01130  Biosynthesis of antibiotics
cdh01200  Carbon metabolism
Module
cdh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDB402_1315 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CDB402_1315 (ppgK)
Enzymes [BR:cdh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CDB402_1315 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEX46617
LinkDB All DBs
Position
1430799..1431560
Genome map
AA seq 253 aa AA seqDB search
MIRMENIGFGIDVGGSGIKGARVNLDTGEFVGDRIKILTPKPATPDAVAETIKRILDQAE
WEGPVGITLPSVIHEQRALTAANIDPSWIDVDVNELFARHLGDTEVSVLNDADAAGLAEA
QFGDPIAREGSVILLTFGTGIGSAFLVNGTLFPNTELGHMLVDGEEAEKIASSAAKDRDE
IGYGKWAKRVSKVLNEYERLFWPSAFIVGGGISRKAEKWVPRLTVNTKVVPAQLRNTAGI
VGAAMAASQNLHP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcatggaaaacatcggattcggtatcgacgttggcggctctggtatcaaggga
gcgcgcgtgaatctagacacaggagaatttgtaggagatcgtatcaagattcttactcct
aaacctgcaacccccgatgcagtcgccgaaacaatcaaacgcatcctcgatcaagccgaa
tgggaagggcctgtcggcattactctaccttccgtcattcacgaacaacgagccctcacc
gccgccaatatcgacccatcgtggattgatgtagacgtaaatgagctatttgctcggcac
ttaggcgacaccgaagtttcggttctcaatgacgccgacgctgcgggattggcagaagcc
caatttggcgatcccattgcacgtgaaggaagtgtaatccttctaacctttggtacaggt
ataggttcagcattcttagtcaacggtacgttgtttcccaacactgaactgggccacatg
cttgtagatggcgaagaagcagaaaaaatcgcatcgtctgcagccaaagatcgcgatgaa
attggatacggaaagtgggctaagcgcgtatcgaaggtgctcaacgaatatgagcggctc
ttttggccatcagcttttatcgtcggtggtggcatctcccgtaaagctgaaaagtgggta
cctcgtctcaccgttaacaccaaggttgtcccagcccagctaagaaacaccgctggaatc
gtaggagctgccatggcagcatcccaaaatcttcacccctaa

DBGET integrated database retrieval system