KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0054Help
Entry
DIP0054           CDS       T00151                                 

Gene name
pknA
Definition
(GenBank) probable serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdi01001]
    DIP0054 (pknA)
Enzymes [BR:cdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DIP0054 (pknA)
Protein kinases [BR:cdi01001]
 Serine/threonine kinases: Other
  Bacterial family
   DIP0054 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal WaaY RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: CAE48562
UniProt: Q6NKH2
LinkDB All DBs
Position
complement(45712..47217)
Genome map
AA seq 501 aa AA seqDB search
MTQSQSPDPALQALVGSDYALQWVVGNGGMSTVWLADDLRNQREVAIKVLRPEFSDNEEF
LSRFRNEALASEHIDSDNVVRTYDYREVTDDMGRTLCFIVMEYVRGESLADMLARKGRLE
EDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGQVKITDFGIAKAAAAVPLTRT
GMVVGTAQYVSPEQAQGRDVTAATDVYSLGVVGYEMLVGQRPFTGDSSVSVAIAHINQAP
PAMPTSVSAPARELIGIALRKDPAHRYADGNELALAVSATRMGQRPPQPKSAPLQHIAPQ
PAPTESTYALGATAQPTTVIPATGQVPAAPAAAAYPASTVIPAGTPRQEPEKQSSGWGAG
IVVGALAALLLGTAAWAASQGMFDDLFDKTSQSSESSVPPPPVTATVTETPTPQITTVIP
EPLPTSSPEPTPSETEHTPDDSHPSSDHQLPSVRPSHNGRPSSQAPHAPTQDADQPAESP
APDTLGSLIENLNKLNQGGAQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatcacagtcacctgatccggcactgcaggcactcgtcggttccgactacgcc
ctgcaatgggtggtgggcaacggtggaatgtccacggtttggcttgccgacgacctccgc
aaccagcgcgaagtggccatcaaggtgttgcgcccagaattctccgacaacgaagaattc
ctctcacgcttccgcaacgaggcactcgccagcgagcacatcgactccgacaacgtggtg
cgcacttacgactaccgcgaagtcaccgacgacatgggccgcaccctgtgcttcatcgtg
atggaatacgtccgcggcgaatccctcgccgacatgctggcacgcaaaggtcgcctcgaa
gaagaccttgctctcgacgttctcgagcaggcagcccacgggctatccatcatccatcgc
atgggtatggtccaccgcgacatcaaacctggcaaccttttgatcactcaaaacggccag
gtaaaaattaccgacttcggtatcgccaaagcagccgcagcagtaccactgacgcgaacg
ggcatggtggtgggcaccgcccagtatgtctccccagagcaagcgcagggccgcgatgtt
accgcagctaccgacgtctactccctaggcgttgtgggatacgagatgctggtgggtcag
cgccccttcaccggcgactcctcggtttctgtggctatcgcccacatcaaccaagcccca
ccggctatgcccactagtgtgtccgccccggcgcgcgagctgatcggcattgcgctgcgc
aaggatccggcacaccgttatgccgatggcaacgagctggcattggcggtttctgctacc
cgtatggggcagcgcccgccacagccgaagtcggcaccattgcagcatattgcgccgcag
ccggctcccacggaatccacctatgcgttgggggctactgcgcaaccgacgacggttatt
ccggctaccggccaggtgcctgctgctcccgctgctgctgcgtatccggcatcgacggtg
attcctgctggcacgccacgccaggagccggagaagcaatctagcggttggggtgccggc
attgtggtcggcgcgttggccgcattgttgttgggtactgctgcgtgggctgcaagtcag
ggcatgtttgatgacctttttgataagacgtcgcaaagctcggagtcctcggttccgccg
ccacctgtgacggctaccgtgacggagactcccacaccgcagatcactactgtgatcccg
gagccgttgcctacgtcgagcccagagccaactccgagtgaaacggagcatactcctgac
gattcgcacccatcgtcggatcaccagttgccttcggtgcgcccgtcgcataatggtcgc
cccagctcgcaagcgccacatgcgcctacgcaggatgctgatcagcctgccgaatcacct
gctcccgatactctcggttctttgatcgagaatctgaacaagctcaaccaaggaggtgcc
cagtga

DBGET integrated database retrieval system