KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0533Help
Entry
DIP0533           CDS       T00151                                 

Definition
(GenBank) Putative glycosilase
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CAE49044
UniProt: Q6NJ79
LinkDB All DBs
Position
complement(500305..502095)
Genome map
AA seq 596 aa AA seqDB search
MHPNCNDIAQPHPLLPMDINRALARNEPICRYFYPHTTTPTTPLVITSYLTTKNTSRELS
TIESMTSKSLPTRTTLSSGTFYQIYPPSFADSNKDGIGDFRGIISRLDYLSDLGITGIWL
NACFDSPFKDGGYDVRDYTKVASRYGTHEDLVELFHQAHARGIAIILDLVPGHTSEQHPW
FQQSAASKYTDFDDRYIWTSHAFEGGAGLAFIGGEHPRNGAYIINFFKSQPALNYGFAEL
TQPWHQPVDAPGPRANQDAMVEIMKYWLSQGADGFRVDMADSLVKNDGTSKRATIGIWQS
MLSQVRAEFPNAIFVSEWGTPTQAFEAGFDADFYLDWRGNGYNLLARNTDTPLERRDDAS
FFNSDSATGAQEFLDMYLPQWERTHEAGLFSFISGNHDCPRLAPRLNEQERALFFLFQLT
MPGLPFIYYGDEIGLPYAEIPTKEGGYARTGSRTPMCWDSQLPNGGFSLGDAPLYLPMTD
TSQNVAQQRERADSLFHHVQKLIQLRSQLPALDGFADLEFDLSLLKKHPKVMVYRRTHHH
GDSVLIALNAGNKPIRVELQQPQAHELFRCGDVTYPDLSDHSVVELGPTSGVILSV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
gtgcacccgaactgcaacgatatagcgcagccgcatcccctacttccgatggatattaac
agagccttagctagaaatgaaccaatttgcagatatttttatccccacaccactaccccc
actaccccactggtaataacctcatacctcacaacgaaaaacacctcgcgtgagctcagt
acgatagagagcatgacgtcgaaaagccttccaactcgcaccacgttaagctcgggaacg
ttctatcagatttaccctcctagctttgccgattctaataaagacggcatcggagatttc
cgtggaatcatctcgcgactcgactatctcagcgaccttggcatcaccggaatctggctc
aacgcgtgctttgattcaccttttaaagacggcggctacgatgtgcgcgactacacaaag
gtggcttctcggtacggcacccatgaggatttggtggagcttttccaccaagcgcatgcc
cgcggaattgccattatcttggatctggttcctggtcacaccagcgaacaacacccttgg
tttcaacaaagtgctgctagtaaatacacagattttgatgaccgctatatttggacttcg
cacgcatttgagggtggtgcggggctagcttttattggcggcgaacacccccgcaacggt
gcgtacattattaatttcttcaaatctcaacctgcactcaattatggtttcgcagaatta
acccagccatggcaccaaccagtagatgcccctggcccgcgggcaaatcaagacgcgatg
gttgagattatgaagtactggttatcgcaaggtgccgatggtttccgcgtggatatggcg
gattcgcttgtgaaaaacgacggcacctcaaagcgggccacgattggtatttggcagtct
atgttgagccaagttcgcgccgagtttcctaatgccatctttgtctcggagtggggcacg
cctactcaagcgtttgaggcgggctttgacgctgacttttacctcgattggcgcggcaat
ggttacaaccttttggcacgtaacacggataccccactggagcggcgcgatgatgcaagt
ttctttaactctgattccgctacgggtgcccaagagtttctcgatatgtatttgccgcaa
tgggagcgcacccatgaggcagggctgtttagttttatcagcggtaaccatgactgcccg
cgtcttgcaccacgcctgaatgaacaagaacgcgcgttgttcttcttgttccagctcact
atgcctggccttcctttcatttattacggggatgaaattgggcttccctatgcggagatc
cctacgaaggagggcggctatgcgcgcacggggtcgcgcacccccatgtgctgggattcc
cagttgcctaacggcggtttttcgcttggcgacgctcccctgtacctccccatgactgat
acatcccagaatgtggcgcagcagcgtgagcgtgcggattcgttgttccatcacgtacaa
aagctcattcagttgcgttctcagctgccagctttagatggctttgctgatctagagttt
gatctttctctcctaaagaagcaccccaaggttatggtgtatcgccgcactcatcatcat
ggcgacagcgtgcttattgccctcaatgcaggtaacaagccgatacgcgtcgagcttcag
cagccccaagcacatgagcttttccgttgtggtgatgtgacatatcccgatctctcagat
cacagcgtggttgagttgggtcctacttctggcgtcatcttgtccgtgtaa

DBGET integrated database retrieval system