KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1122Help
Entry
DIP1122           CDS       T00151                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00620  Pyruvate metabolism
cdi00680  Methane metabolism
cdi01100  Metabolic pathways
cdi01120  Microbial metabolism in diverse environments
cdi01200  Carbon metabolism
Module
cdi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DIP1122 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    DIP1122 (ppc)
Enzymes [BR:cdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DIP1122 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 WbqC
Motif
Other DBs
NCBI-ProteinID: CAE49642
UniProt: P61448
LinkDB All DBs
Position
1106381..1109089
Genome map
AA seq 902 aa AA seqDB search
MTAAISDRVREDIRLLGRVLGRVIAQQEGEEVYELVEATRRMAFDVSHGDADPEDLMVIF
RDLDITKTNLVARAFSYFALLANLVEDLDDESVEADVSLRKTFAKLKREGVSAADAASVI
RSAEVAPVLTAHPTETRRRTVFDTQTRIKQLLKDAHHGGDMQVIEQEMYLRMTLLWQTAL
IRIARPTLEDEIDVGLRYYKKSLLEQVPALNRSIRHSMRETFGLQLPDIAVMRPGSWIGG
DHDGNPYVNARTLTYATRQAAKTVARYYVEQLGELERELSLSDRYSSCSKELLALAEASG
NNWESRVDEPYRRAVYGMRARMKSNVDALERPEKTAGKKSSKRTPYATPEEFLRDLDVID
RSLRAHNDDVIADDRLARIRSAVTTFGFHLYTLDIRQNSESFEAVIEEVFAAARRVPGGK
RYSELAEAEKVELLIQELQTPRPLLFPGALEVEDAFSADTTKELGIFLAAAQAVRDFGSR
SIAHCIISMTATVSDILEPMVLLKEVGLRDVDVVPLFETIDDLRCGAAILRELWSHPFYR
EHLRARGDIQEVMLGYSDSNKDGGYLQANWALYDAELGLVELCREHNIELRLAHGRGGAV
GRGGGPTYDAILAQPKGAVSGSVRITEQGEVISAKYGAPETARRHLEAFVSGALEASLLD
TEPIADPDRAYAIMRDLAGFSGQRYQELVGDPGFIEYFTQSTPLHEIGELNLGSRPAARK
QTTAISDLRAIPWVLSWSQSRTNIPGWFGVGSAVSRFVSAVPEKDRESRWQELRDLYATW
PFFRSVMSNMAQVMAKAEISLARLYADLVDDPEVADRIYALIAEEFELTRRAYLAITGNE
ALVSENQRQARSLKRRYPYLLPLNAIQLELLRRYRGGDDQFLVSKTIQVTMNGLATALRN
AG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctgccatttctgatcgtgtccgtgaagatattcgattgctgggacgcgtacta
ggacgagttattgcgcagcaagagggcgaagaagtctatgagctggtagaagctactaga
cgcatggcgtttgatgtttctcatggtgacgctgatcctgaagatttaatggtgattttt
agggatcttgatatcactaagaccaaccttgttgctcgtgcttttagttattttgcgctg
ctggctaatttggttgaggatcttgatgatgaatccgtagaggcggatgtttcattgcgt
aaaacttttgccaagcttaagcgggagggggtgtctgcagctgatgctgcgagtgtgatt
cgtagtgctgaggttgcaccggtgcttacggcgcatcctacggagacgcgtcgtcgtacg
gtgtttgatactcagactcggatcaagcagttgctcaaagacgcccatcatggtggggat
atgcaggtcattgagcaggaaatgtatctgcggatgacgctcttgtggcaaaccgcgctg
attcgtattgcgcgtccaacgctggaggatgagatcgatgtggggttgcgctattacaag
aagtcactcttggagcaggttcctgcgttgaatcgttcgatccgtcattctatgagggag
acgtttggtctgcagctgccagatattgcggtgatgcgtcctggctcgtggattggtggc
gatcacgatggtaatccgtatgttaatgctcgtaccttgacgtacgcgacgcgtcaggcc
gccaagacagtggcgcgttattacgtggagcagttgggtgaactggaacgcgagctgtcg
ctgtctgatcgttattcttcgtgctccaaggagctgcttgcgttggccgaggcttcgggt
aacaactgggaatcgcgtgttgatgagccgtatcgtcgtgcagtctatgggatgcgcgcc
cgtatgaagtccaatgtggacgctttggagcgtccggagaaaacagcggggaagaagtcg
tcgaaacgcacgccttatgcaactcctgaggagttcttgcgcgatcttgatgtgattgat
cgatcattgcgtgcgcacaatgatgatgtgatcgctgatgatcggctagcgcgtatccgc
tcggctgtaaccacttttgggttccatttgtacactctcgatatccgtcagaattctgag
tcttttgaggctgtgatcgaggaggtattcgcggcagcgcgtcgtgtacccggcggtaag
cgttattcggagcttgctgaggcagaaaaggttgagctgcttatccaggagctgcaaact
ccgcgtccgctgttgttccccggcgcgcttgaggtcgaggatgcgtttagcgctgatacc
actaaggaattggggattttcttagcggcggctcaggcggtgcgggatttcggatcgcgg
tcaattgcgcattgcattatttcgatgacggctacggtgtccgacattttggagcctatg
gtgctgttgaaggaagtcggattgcgtgatgttgatgtggttccgctttttgagactatc
gacgatcttcgctgcggtgctgctattttgcgcgagctgtggtcgcatccgttttatcgt
gagcatcttcgtgcccgtggggatatccaagaggtgatgttggggtattccgattccaac
aaggacggcgggtatctgcaagctaactgggcgttgtatgatgctgagctgggcttggtg
gagttgtgccgtgagcacaatattgagttgcgtttggctcatggccgtggtggcgctgtg
ggccgtggtggtggacctacttacgatgcgattttggcgcagccgaagggtgcggtgtcg
ggttctgttcgtattacggagcagggtgaggtgatttctgcgaagtatggtgcgcctgag
acggcgcgccgtcacttggaggcgtttgtttcgggggcgttggaggcgtcgcttctcgat
actgagccgattgcggatccggatcgtgcgtatgcgattatgcgtgatcttgctggcttt
agtggtcagaggtatcaggagttggtgggagatcctgggtttattgagtacttcacgcag
tcgactccattgcatgagattggtgagcttaatctggggtcgcgtcctgctgcgcgtaag
caaacgacagctatttcagatcttcgtgctattccgtgggtgttgtcgtggtcgcagtcg
cggaccaatattcctggttggtttggtgttggtagcgcggtgagccgttttgtatcggcg
gtgccggagaaggaccgagagtcacggtggcaggagctgcgtgatttgtatgcaacgtgg
ccatttttccgctcggtgatgtcaaatatggctcaggttatggccaaggcagagatctcg
ctggcaaggttgtatgccgatttggtggatgatcccgaggttgctgaccggatttatgcg
ttgattgcagaagaatttgaacttacgcgtcgtgcatatttggctattactggtaatgag
gcactggtgtcggaaaaccagcgccaagcccgttcacttaagcggcgttacccgtatttg
ctaccgcttaacgccattcagctggagttgctgcggcgttatcgtggtggcgatgatcaa
ttcttggtgtctaagactattcaggtcaccatgaatggtttggccactgcgttgcgtaat
gcggggtag

DBGET integrated database retrieval system