KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_01037Help
Entry
ERS451417_01037   CDS       T04861                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Pathway
cdip00620  Pyruvate metabolism
cdip00680  Methane metabolism
cdip01100  Metabolic pathways
cdip01120  Microbial metabolism in diverse environments
cdip01200  Carbon metabolism
Module
cdip_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cdip00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERS451417_01037 (ppc)
  Energy metabolism
   00680 Methane metabolism
    ERS451417_01037 (ppc)
Enzymes [BR:cdip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ERS451417_01037 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 WbqC
Motif
Other DBs
NCBI-ProteinID: CKG88310
LinkDB All DBs
Position
1:1029705..1032476
Genome map
AA seq 923 aa AA seqDB search
MICATLMGTLCIHHFCRKAELVTAAISDRVREDIRLLGRVLGRVIAQQEGEEVYELVEAT
RRMAFDVSHGDADPEDLMVIFRDLDITKTNLVARAFSYFALLANLVEDLDDESVEADVSL
RKTFAKLKREGVSAADAASVIRSAEVAPVLTAHPTETRRRTVFDTQTRIKQLLKDAHHGG
DMQVIEQEMYLRMTLLWQTALIRIARPTLEDEIDVGLRYYKKSLLEQVPALNRSIRHSMR
ETFGLQLPDIAVMRPGSWIGGDHDGNPYVNARTLTYATRQAAKTVARYYVEQLGELEREL
SLSDRYSSCSKELLALAEASGNNWESRVDEPYRRAVYGMRARMKSNVDALERPEKTAGKK
SSKRTPYATPEEFLRDLDVIDRSLRAHNDDVIADDRLARIRSAVTTFGFHLYTLDIRQNS
ESFEAVIEEVFAAARRVPGGKRYSELAEAEKVELLIQELQTPRPLLFPGALEVEDAFSAD
TTKELGIFLAAAQAVRDFGSRSIAHCIISMTATVSDILEPMVLLKEVGLRDVDVVPLFET
IDDLRCGAAILRELWSHPFYREHLRARGDIQEVMLGYSDSNKDGGYLQANWALYDAELGL
VELCREHNIELRLAHGRGGAVGRGGGPTYDAILAQPKGAVSGSVRITEQGEVISAKYGAP
ETARRHLEAFVSGTLEASLLDTEPIADPDRAYAIMRDLAGFSGQRYQELVGDPGFIEYFT
QSTPLHEIGELNLGSRPAARKQTTAISDLRAIPWVLSWSQSRTNIPGWFGVGSAVSRFVS
AVPEKDRESRWQELRDLYATWPFFRSVMSNMAQVMAKAEISLARLYADLVDDPEVADRIY
ALIAEEFELTRRAYLAITGNEALVSENQRQARSLKRRYPYLLPLNAIQLELLRRYRGGDD
QFLVSKTIQVTMNGLATALRNAG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
gtgatctgcgctacattgatgggcacactttgtatccatcacttttgtaggaaggctgag
ctcgtgactgctgccatttctgatcgtgtccgtgaagatattcgattgctgggacgcgta
ctaggacgagttattgcgcagcaagagggcgaagaagtctatgagctggtagaagctact
agacgcatggcgtttgatgtttctcatggtgacgctgatcctgaagatttaatggtgatt
tttagggatcttgatatcactaagaccaaccttgttgctcgtgcttttagttattttgcg
ctgctggctaatttggttgaggatcttgatgatgaatccgtagaggcggatgtttcattg
cgtaaaacttttgccaagcttaagcgggagggggtgtctgcagctgatgctgcgagtgtg
attcgtagtgctgaggttgcaccggtgcttacggcgcatcctacggagacgcgtcgtcgt
acggtgtttgatactcagactcggatcaagcagttgctcaaagacgcccatcatggtggg
gatatgcaggtcattgagcaggaaatgtatctgcggatgacgctcttgtggcaaaccgcg
ctgattcgtattgcgcgtccaacgctggaggatgagatcgatgtggggttgcgctattac
aagaagtcactcttggagcaggttcctgcgttgaatcgttcgatccgtcattctatgagg
gagacgtttggtctgcagctgccagatattgcggtgatgcgtcctggctcgtggattggt
ggcgatcacgatggtaatccgtatgttaatgctcgtaccttgacgtacgcgacgcgtcag
gccgccaagacagtggcgcgttattacgtggagcagttgggtgaactggaacgcgagctg
tcgctgtctgatcgttattcttcgtgctccaaggagctgcttgcgttggccgaggcttcg
ggtaacaactgggaatcgcgtgttgatgagccgtatcgtcgtgcagtctatgggatgcgc
gcccgtatgaagtccaatgtggacgctttggagcgtccggagaaaacagcggggaagaag
tcgtcgaaacgcacgccttatgcaactcctgaggagttcttgcgcgatcttgatgtgatt
gatcgatcattgcgtgcgcacaatgatgatgtgatcgctgatgatcggctagcgcgtatc
cgctcggctgtaaccacttttgggttccatttgtacactctcgatatccgtcagaattct
gagtcttttgaggctgtgatcgaggaggtattcgcggcagcgcgtcgtgtacccggcggt
aagcgttattcggagcttgctgaggcagaaaaggttgagctgcttatccaggagctgcaa
actccgcgtccgctgttgttccccggcgcgcttgaggtcgaggatgcgtttagcgctgat
accactaaggaattggggattttcttagcggcggctcaggcggtgcgggatttcggatcg
cggtcaattgcgcattgcattatttcgatgacggctacggtgtccgacattttggagcct
atggtgcttttgaaggaagtcggattgcgtgatgttgatgtggttccgctttttgagact
atcgacgatcttcgctgcggtgctgctattttgcgcgagctgtggtcgcatccgttttat
cgtgagcatcttcgtgcccgtggggatatccaagaggtgatgttggggtattccgattcc
aacaaggacggcgggtatctgcaagctaactgggcgttgtatgatgctgagctgggcttg
gtggagttgtgccgtgagcacaatattgagttgcgtttggctcatggccgtggtggcgct
gtgggccgtggtggtggacctacttacgatgcgattttggcgcagccgaagggtgcggtg
tcgggttctgttcgtattacggagcagggtgaggtgatttctgcgaagtatggtgcgcct
gagacggcgcgccgtcacttggaggcgtttgtttcggggacgttggaggcgtcgcttctc
gatactgagccgattgcggatccggatcgtgcgtatgcgattatgcgtgatcttgctggc
tttagtggtcagaggtatcaggagttggtgggagatcctgggtttattgagtacttcacg
cagtcgactccattgcatgagattggtgagcttaatctggggtcgcgtcctgctgcgcgt
aagcaaacgacagctatttcagatcttcgtgctattccgtgggtgttgtcgtggtcgcag
tcgcggaccaatattcctggttggtttggtgttggtagcgcggtgagccgttttgtatcg
gcggtgccggagaaggaccgagagtcacggtggcaggagctgcgtgatttgtatgcaacg
tggccatttttccgctcggtgatgtcaaatatggctcaggttatggccaaggcagagatc
tcgctggcaaggttgtatgccgatttggtggatgatcccgaggttgctgaccggatttat
gcgttgattgcagaagaatttgaacttacgcgtcgtgcatatttggctattactggtaat
gaggcactggtgtcggaaaaccagcgccaagcccgttcacttaagcggcgttacccgtat
ttgctaccgcttaacgccattcagctggagttgctgcggcgttatcgtggtggcgatgat
caattcttggtgtctaagactattcaggtcaccatgaatggtttggccactgcgttgcgt
aatgcggggtag

DBGET integrated database retrieval system