KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_01046Help
Entry
ERS451417_01046   CDS       T04861                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Pathway
cdip00473  D-Alanine metabolism
cdip00550  Peptidoglycan biosynthesis
cdip01100  Metabolic pathways
cdip01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ERS451417_01046 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ERS451417_01046 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ERS451417_01046 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdip01011]
    ERS451417_01046 (ddl)
Enzymes [BR:cdip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ERS451417_01046 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:cdip01011]
 Precursor biosynthesis
  Amino acid ligase
   ERS451417_01046 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 ATPgrasp_ST CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: CKG88578
LinkDB All DBs
Position
1:1039721..1040818
Genome map
AA seq 365 aa AA seqDB search
MSQNLSAQNSSETPRIKVAIIYGGRSSEHSVSCVSAGAIMAHLDPQRYEVFPVGITHDGV
WTVGEPDPTRLKTVDRVMPEVQFTREVSLSVNPNTAGELRFEDGSLYAKVDVVFPVLHGR
FGEDGTIQGLFELSGVPYVGTGVLSSACGMDKEFTKKLMAAEGLPVGKEVILRGSETLTE
EHKRELGLPVFVKPARGGSSIGISRVADWSEWDAALSLAREHDSKVIVETEIVGVEVECG
VLERIDGSLMASVPAQLQDTDEGDEGFYGFDTKYLDDVVTAHIPAPFDAETTALIQELSL
KAFTALSCRGLARVDFFVTDHGPVLNEINTMPGFTPISMYPQVFEATGIGYAQLLDNLIE
QALHK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaaaatctttcagcacagaactcttcagaaactcctcgtattaaagttgccatc
atctatggtggccgcagctcagaacattccgtgtcgtgtgtgtctgccggcgctattatg
gcgcaccttgatccgcagcgctacgaggtgttcccagtaggtatcacgcacgacggtgtg
tggactgtgggggaaccggatccgactcggcttaagactgtcgaccgtgtgatgccagag
gttcagttcacaagggaagtatcgttgtcggtcaacccaaacaccgctggcgagctacgt
ttcgaggatggatcgctttatgccaaagtcgatgtagtcttcccagtcttgcatggtcgc
tttggcgaagacggtacgatccaaggtctatttgagctctctggtgtgccctacgttgga
actggtgtgttgagctccgcttgcggaatggacaaggaatttactaagaaactcatggcg
gctgaaggtttgccagttggcaaggaagttatccttcgcggctcggaaacgttgactgaa
gaacataagcgtgagcttggtttgccagtgtttgttaaacctgctcgtggtggatcatcc
attggtatttctcgtgtagctgattggagcgaatgggacgcggcattgagtcttgcacgc
gagcacgattccaaggtgatcgtcgagactgaaattgtgggtgtagaagtcgaatgcggc
gtgcttgagcgtatcgacggttccctgatggcgtctgttcccgcccagctgcaagatacc
gatgagggtgacgaaggtttctatggttttgataccaagtacctggacgatgtggtcacc
gctcacattccagcgcccttcgacgcggaaactactgcgttgattcaagagctgtcgctg
aaggctttcacagctttaagctgccgtggtttggcacgcgtggacttctttgtcaccgac
catggacctgtgctcaacgagatcaataccatgccaggatttacccctatttcgatgtac
ccccaggtattcgaggcaacaggtatcggttatgcgcagctgctcgataacttgatcgag
caggccttgcacaaataa

DBGET integrated database retrieval system