KEGG   Cuniculiplasma divulgatum: CPM_0030Help
Entry
CPM_0030          CDS       T04682                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cdiv  Cuniculiplasma divulgatum
Brite
Enzymes [BR:cdiv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CPM_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF3106
Motif
Other DBs
NCBI-ProteinID: SJK83934
UniProt: A0A1R4A4P4
LinkDB All DBs
Position
I:38572..39189
Genome map
AA seq 205 aa AA seqDB search
MVEKWEKKNQFKPKGLDGISDQQIEYHFETHYNGYVTKLNEIWEKLPNADRSKANQNYSE
FRELKLEETFNYDGSLLHEIYFESLKKDGLKNLSEELKKKISEDFGSYEKWVEDFKATGT
AFRGWALLVYDLNTGKLRNIGADVHNTNGIWNAIVVMALDVYEHAYYVDYGAKRAPYLDA
FMKNVDWASVNKRFEKAHKAYLAFK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaatgggaaaagaaaaatcaattcaagccaaagggactggatggtatatca
gatcagcaaatagaatatcactttgagacgcattataatgggtacgtcacaaagttgaat
gagatttgggaaaaacttccaaatgcagacagaagcaaggcaaaccagaattacagcgaa
ttcagggaacttaagctggaagaaaccttcaattatgatggttcgcttcttcacgagata
tatttcgagtcactgaaaaaggatggtctcaagaatctatctgaagaactgaaaaagaag
atctcagaagatttcggaagctatgagaaatgggttgaggactttaaggctactggtact
gcattcaggggatgggcacttcttgtatatgacctgaacaccggaaagctgagaaacatt
ggtgctgatgtacacaacacaaatggaatatggaatgccatagtcgtcatggctctagat
gtctacgaacacgcatattacgtagactacggggcaaagagggcaccatatctggacgca
ttcatgaagaatgtagattgggcatcagtgaacaagagattcgaaaaggctcacaaggca
tatctcgcattcaaataa

DBGET integrated database retrieval system