KEGG   Carnobacterium divergens: BFC22_04460Help
Entry
BFC22_04460       CDS       T05644                                 

Definition
(GenBank) DNA-binding response regulator
Organism
cdj  Carnobacterium divergens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: ANZ99399
UniProt: A0A494QJL9
LinkDB All DBs
Position
986134..986853
Genome map
AA seq 239 aa AA seqDB search
MKILMIEDNQSVCEMMEMFFLKEDWDALFKQDGKEGLDAFLTQPNAWDIITLDLNLPTMD
GIQICREIRKVSKTVPIIMLTAKDSESDQVIGLEMGADDYVTKPFSPLTLIARIKALHRR
ADLGHEEGMESSAKNADFEVETDHLKINTKTREAFLYHKPIEGLTPKEFELLYTLAKNPK
QVFSREQLLTIVWDYQYYGDERTVDAHIKKLRQKIEKTGPQVIQTVWGVGYKFDDTGVE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaatgattgaagacaaccaatctgtctgtgaaatgatggaaatgtttttc
ttaaaagaagattgggatgcactgtttaaacaagatggaaaagaaggtttagatgcattt
ttgacacaacctaatgcttgggatattattaccttagatttaaatttacctacaatggat
ggtattcaaatttgccgtgaaattcgaaaagtttcaaaaacagttccaattattatgttg
actgctaaagattcagaaagcgatcaagtaattgggttagaaatgggagctgatgattat
gtaacaaaaccatttagcccgctaaccttaattgcacgaatcaaagcacttcatcgtcga
gcagatttaggacatgaggaaggtatggaaagctcagcaaaaaatgcagattttgaagtt
gaaacagatcaccttaaaattaatactaaaactagagaagcctttttgtatcataaacca
attgaaggactcacaccaaaagaatttgaattgttatatacacttgctaaaaatcctaaa
caagtcttttcaagagaacaactattaacgattgtttgggattatcaatactatggagat
gaacgaacggttgatgcccatattaaaaagttgcgtcaaaaaattgaaaaaacaggtcca
caagtgattcaaacagtttggggtgttggatacaaatttgatgacactggagttgagtag

DBGET integrated database retrieval system