KEGG   Carnobacterium divergens: BFC22_08545Help
Entry
BFC22_08545       CDS       T05644                                 

Definition
(GenBank) potassium transporter Trk
  KO
K03499  trk system potassium uptake protein
Organism
cdj  Carnobacterium divergens
Brite
KEGG Orthology (KO) [BR:cdj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdj02000]
    BFC22_08545
Transporters [BR:cdj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BFC22_08545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N TrkA_C NAD_binding_2 F420_oxidored ADH_zinc_N NAD_binding_7 3HCDH_N UDPG_MGDP_dh_N ApbA Shikimate_DH NmrA 2-Hacid_dh_C Castor_Poll_mid IMPDH NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AOA00151
LinkDB All DBs
Position
complement(1833825..1834484)
Genome map
AA seq 219 aa AA seqDB search
MKKNFAIIGLGRFGGSICRTLVEAGQDVLVIDSSEDRVNEFMNIATHAVVANAQDESVLR
SLGIRNFDHVIVAIGEDIQASILATLMIKEMGVPFVTAKAQNDYHGKVLERIGADHVVHP
ERDMGIRIGHHLVSKNVVDYLELSDEYSLVELKVTNPKFYRKSLDELDFRAKFGLTVIGI
RRGQEMIISPKATETIEENDTLMVVGSVIDLDRLEVMMP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaactttgcgattattggattaggtcgttttggcggtagtatttgccgtacg
ttagtagaagctggtcaagatgtgttagtcattgactcaagtgaagaccgtgtaaatgaa
tttatgaatatcgcgactcatgcagtagtagcaaatgctcaagatgaaagtgtgttacga
tcattaggcattcgtaattttgatcatgttattgttgcaattggggaagacattcaagcc
agtattttagctactttaatgattaaagaaatgggtgttccctttgtaacagctaaagca
caaaatgattatcacggaaaagtattagaacgcattggggcagatcacgttgttcatcct
gaaagagacatgggaattcgtataggacatcatttagtttctaaaaatgtggtggactat
ttggagctgtcagacgaatattcgttagtagaattaaaggtaacgaatccaaaattttat
cgcaaatcactggatgaactagattttagagcaaaatttggtttgacagtcattgggatt
cgacgcgggcaagaaatgattatttcaccaaaagcaacagaaacgattgaagaaaacgat
acgttgatggttgtaggatcagtcattgatttagaccgtttagaagtaatgatgccttaa

DBGET integrated database retrieval system