KEGG   Camelus dromedarius (Arabian camel): 105084258
Entry
105084258         CDS       T04642                                 

Gene name
SORBS1
Definition
(RefSeq) sorbin and SH3 domain-containing protein 1 isoform X1
  KO
K06086  sorbin and SH3 domain containing 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04520  Adherens junction
cdk04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105084258 (SORBS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105084258 (SORBS1)
   03320 PPAR signaling pathway
    105084258 (SORBS1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 Sorb
Other DBs
NCBI-GeneID: 105084258
NCBI-ProteinID: XP_010972629
LinkDB
Position
11
AA seq 1552 aa
MSSECDVGASKAVVNGLAPGSNGQDKATADPLRARSISAVKIIPVKTMKNSAGLVLPPDT
DPTKICTGKGAVTLRASSSYREMPSGSPVSPREAPQHAGTPVLESENSSADEWRLSSNAD
ANGNAQPSSLAAKGYRSVHPSLPSDKPQVLSPPRRPPRPMEDRFAWQSPSTHSPYKDSLY
LSSPKPYVPPSTPSQQSPSRPQLVPVALAARSAPKGVPHPGPPLPGSTFPGASAQPQQRY
AAARTVERENVSSNPRHEAVGNKKVSSLYVPCLSHNIRWVASESLSRVARDPAKGTPREA
AGTRAPAPSLVSRTSGTGRPPSAPPPDPPKLFFDIRKDAVNRGGSPSLGTQSPFPDAVRP
PVLGPQVTSDPENRKRKEPYLLQPWCPAKDATSSSPAQPEVIVVPLYLVNTDRGHEGTDR
PPASLGPRGPPVPATTPAGSPLALPTLDDFIPPHLQRWSHHSQPARAPGSFPPASQTPPS
FSPPPPLVPPVPEGLRRASEPGLKGAVSSTDSSPPLNEVSLSHVGTDSQTSAPVSKPPSA
YPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDLAPTQEKPSSPGRAPERKAK
DDSRRAAKSAQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYK
FPELPEIQQNSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSK
SEMNYIDGEKVVKRSATLPLPTRSSSLKSSPERNDWEPPDKKVDTRKYRAEPKSIYEYQP
GKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDR
KTNLEKDLNLCQTELEADLEKPETLNKAPSANLSQSSAVSPTPDISSEPPGYIYSSNFHA
VKRESDGAPGDLASLESERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPA
DYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDL
LNIDDTAKRKSGSEMRPARAKYDFKAQTLKELPLQKGDIVYICKQIDQNWYEGEHHGRVG
IFPRTYIELLPPAEKAQPKKLTPVQILEYGEAVAKFNFNGDTQVEMSFRKGERITLLRQV
DENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYIDLPFSSSPSRSATASPQFPGPS
KLITPAPSSLPHAHRALSPEMQAVTSEWISLTVGVPGRRPLALTPPLPPLPEASVYSTDP
LAWLARPSPSLSLNLPYSSWSDRSTPHSAVSPLALPPPHKACSLVPGAQGSLHVNGDSGT
HVSPLGLHQDSFSQPQPGSSDRVISELSDAFSSQGKQQPWREERGPHERKTEREAGETCP
GGPAISKKSCLRPSDVVRCLSTEQRLAELHSPEESRPRQALGSPFPGREAKHTELHRGGE
QAERKAARTGASQPSHHSLRAGPDLTDSEKSYVQPQAQQRRVTPDRSQTSQDLLSYQALY
SYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTRQFGTFPGNYVKPLYL
NT seq 4659 nt   +upstreamnt  +downstreamnt
atgagctctgaatgtgacgtcggtgcttccaaagccgtggtgaacgggttggccccgggc
agcaatgggcaagacaaagcaactgccgaccctttacgtgcacgctctatttctgctgtt
aaaataatccctgtgaagacaatgaaaaactctgcaggcctagtactccctccagacacg
gatcctacaaaaatctgcactgggaaaggagcggtgactctccgggcctcgtcctcctat
agggaaatgccgagcggaagccctgtgagccctcgagaagccccacagcatgcagggaca
ccagttctggagtcagagaattcctcagcagatgagtggaggctttcttccaatgccgat
gccaatggaaacgcccagccctcttcacttgctgccaagggctacagaagcgtgcatccc
agccttccttccgacaagccccaggtcctctctcccccacgtcgtcctcctcgccctatg
gaggaccgctttgcatggcagtcccccagcacccacagcccctacaaggactccctctac
ctgagctcacccaagccttatgtcccgcccagcacccccagccagcagagcccctcacga
ccccagctggtccctgtcgccttggcagccagatcagcccccaaaggtgtgccacatccc
gggcccccgcttccgggttccacattccccggcgcttcggcccaaccccagcagcgctat
gcagccgccaggacagttgagagagagaatgtgagctctaacccacgtcatgaggcagtt
gggaataaaaaggtcagcagcttatatgtaccttgtttatcgcacaacattcgctgggtg
gcatcggaaagcctctcccgtgttgcacgtgacccagccaaaggcactccccgggaagct
gcaggcactcgagcaccggcgcccagccttgtctcccgcacctccggcactggaaggcca
ccctctgctcctcctcctgaccctcccaagctattctttgacatccgtaaagatgccgtt
aaccgtggcgggagtccttcactggggactcagtctccgttcccagatgcagtgagacca
cctgtgctaggtccccaggttacctctgatcccgaaaaccggaagagaaaagagccttac
cttttgcagccgtggtgtccagccaaggatgccacgtcctccagcccagcccagcccgag
gtcatagttgtccctctctacctggttaacactgacagaggtcacgaaggcactgacaga
cccccagcatctctggggccacgcggccccccggtcccggcgaccacccccgccggctca
cctctggccttgccaactctagatgatttcattccccctcacctgcagaggtggtcccac
cacagccagccagcccgtgctcctggctccttccctcccgcgagccagacgccaccatcc
ttctcaccaccgcctccgctggtccctccggtgcccgagggcctccgcagagcctcggag
cctggcctcaagggagctgtttcaagtaccgactcaagtcccccactaaatgaagtctct
ttgtcccacgttggaactgactcccaaacctctgcaccagtcagcaagccaccatctgcc
tacccctccacgacgatcgtcaaccccaccatcgtgctcctgcagcacaaccgagaacag
cagaagcgactcagtagcctttcagatcctgtctcggaaagaagagtgggggagcaggac
ttggcaccgactcaggaaaagcctagctccccgggcagggctcctgagaggaaggcaaag
gatgacagcaggcgggcagctaagagcgctcaggacctgagcgatgtgtccatggatgaa
gtgggcatccccctccggaacactgagagatcaaaagactggtacaagaccatgtttaaa
cagatccacaaactgaacagagacactcctgaagaaaacccttatttccctacgtacaaa
ttccctgaacttcctgaaatccagcaaaattctgaagaggacaatccttacactcctacc
taccagtttcctgcatctactcctagtcctaaatctgaagatgatgattcagatctgtac
tctcctcgatattccttttctgaagacacaaaatctcccctttctgtgcctcgctcaaaa
agtgagatgaactacattgatggtgagaaggtagttaagaggtcggccacacttcccctc
ccgacccgctcttcttcgctaaaatcaagcccagagagaaacgactgggagcccccagat
aagaaagtggatacaagaaaataccgggcagagcccaaaagcatttacgaatatcagccg
ggcaagtcctccgttctgaccaacgaaaagatgagtcgggatataagcccagaagagata
gatttaaagaatgaaccttggtataaattcttttcggaattggagtttgggaaaccgcct
cccaaaaagatatgggattatactcctggagactgctctatccttcctagagaggataga
aagactaacctagaaaaagatctcaacctctgccaaacagagttagaggcagacttagaa
aaaccggagacgcttaataaagcacccagtgcaaacctgtcacagagctctgcagtcagc
cccactccggacatttcttcagagcctcctggatatatatattcttccaacttccacgcc
gtgaagagggaatcagatggggctcctggggatcttgctagcttggagagcgagaggcag
atttacaaaagcgtcttggaaggaggagacatccctctccagggcctgagcggcctcaag
cggccatccagctcagcctccactaaagattcagaatcaccaaggcattttataccggct
gattacttggaatccacagaagaattcattcgaagacgtcatgatgataaagagaaactt
ttagcggaccagagacgacttaagcgcgagcaagaagaggccgatattgcagctcgacgc
cacacgggcgtcattccaacgcaccatcagtttatcactaatgagcgctttggggacctc
ctcaatatagacgatacggcaaaaaggaaatctgggtcagagatgagacctgccagagcc
aagtatgactttaaagctcagacactaaaggagcttccgctgcagaagggagacatcgtt
tacatctgtaagcagatcgatcagaactggtacgaaggagagcaccatggccgggtgggg
atcttcccacgcacctacattgagcttctccctcccgccgagaaggctcagcccaaaaag
ctgacaccagtacaaatcctggaatacggcgaagctgtcgctaagtttaactttaacggt
gacacgcaagtagaaatgtccttcagaaagggcgagaggatcacactgcttcgacaggtg
gacgagaactggtacgaagggaggatcccggggacgtcccggcaaggcatcttccccatc
acctatgtggacgtgatcaaacggccactggtgaaaaaccccgtggattacatcgacctg
cctttctcctcctccccaagccgcagtgccactgcaagccctcagtttcctggtcctagc
aagctcatcacgccagccccctcatctctgccccacgctcaccgagccctatcccctgag
atgcaggctgtcacctctgagtggatctcactgactgtaggggtcccgggcaggcgccct
ctggccctgaccccacccttgcctcctctgcccgaggcttcagtctacagcactgacccc
ctggcctggttggcgaggcccagcccctccctgtccctcaacctcccctattcaagctgg
tcggaccggtccaccccacactcggcagtctccccactggccctgcctcctccacacaaa
gcctgttccctggtgcctggtgcccagggctccctccatgtcaacggagacagtggtacc
catgtgtcacctctggggctccaccaggatagcttctcccagccgcagcctgggagttct
gacagggtcatctcggagcttagtgacgcctttagcagccagggtaagcagcagccgtgg
cgagaagaaagaggaccacatgagaggaaaacagagagggaggcaggtgagacatgccca
ggtggacccgccatctctaagaagagctgcctgagaccttcagacgtggtccggtgcctg
agcaccgaacagagactcgcagagctccacagccccgaggagagccggccccgccaggcc
ctgggtagccctttcccgggaagggaggccaagcacacagagctgcatagaggtggcgag
caggccgagaggaaggccgctcggactggtgcgagccagccttctcatcattcattgaga
gcaggacctgatctcacagactctgaaaagagctatgtgcaacctcaagcccagcagcga
agagtcaccccagacaggagtcaaacctcccaggatttacttagctaccaagcactgtat
agctatattccacagaacgatgacgaattggagctccgagatggagatattgttgacgtc
atggagaagtgtgacgacgggtggtttgttggtacttcaagaaggacaaggcagtttggt
actttcccaggaaactacgtaaagcctttgtatctataa

DBGET integrated database retrieval system