KEGG   Camelus dromedarius (Arabian camel): 105084316
Entry
105084316         CDS       T04642                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01523  Antifolate resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04068  FoxO signaling pathway
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04380  Osteoclast differentiation
cdk04620  Toll-like receptor signaling pathway
cdk04621  NOD-like receptor signaling pathway
cdk04622  RIG-I-like receptor signaling pathway
cdk04623  Cytosolic DNA-sensing pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04657  IL-17 signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04668  TNF signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk05010  Alzheimer disease
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05145  Toxoplasmosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05212  Pancreatic cancer
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105084316 (CHUK)
   04014 Ras signaling pathway
    105084316 (CHUK)
   04064 NF-kappa B signaling pathway
    105084316 (CHUK)
   04668 TNF signaling pathway
    105084316 (CHUK)
   04068 FoxO signaling pathway
    105084316 (CHUK)
   04151 PI3K-Akt signaling pathway
    105084316 (CHUK)
   04150 mTOR signaling pathway
    105084316 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105084316 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105084316 (CHUK)
   04621 NOD-like receptor signaling pathway
    105084316 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    105084316 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    105084316 (CHUK)
   04625 C-type lectin receptor signaling pathway
    105084316 (CHUK)
   04660 T cell receptor signaling pathway
    105084316 (CHUK)
   04658 Th1 and Th2 cell differentiation
    105084316 (CHUK)
   04659 Th17 cell differentiation
    105084316 (CHUK)
   04657 IL-17 signaling pathway
    105084316 (CHUK)
   04662 B cell receptor signaling pathway
    105084316 (CHUK)
   04062 Chemokine signaling pathway
    105084316 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105084316 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105084316 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105084316 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105084316 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105084316 (CHUK)
   05221 Acute myeloid leukemia
    105084316 (CHUK)
   05220 Chronic myeloid leukemia
    105084316 (CHUK)
   05215 Prostate cancer
    105084316 (CHUK)
   05222 Small cell lung cancer
    105084316 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105084316 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105084316 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105084316 (CHUK)
   05135 Yersinia infection
    105084316 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105084316 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    105084316 (CHUK)
   05161 Hepatitis B
    105084316 (CHUK)
   05160 Hepatitis C
    105084316 (CHUK)
   05171 Coronavirus disease - COVID-19
    105084316 (CHUK)
   05164 Influenza A
    105084316 (CHUK)
   05162 Measles
    105084316 (CHUK)
   05168 Herpes simplex virus 1 infection
    105084316 (CHUK)
   05163 Human cytomegalovirus infection
    105084316 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105084316 (CHUK)
   05169 Epstein-Barr virus infection
    105084316 (CHUK)
   05165 Human papillomavirus infection
    105084316 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105084316 (CHUK)
   05142 Chagas disease
    105084316 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    105084316 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105084316 (CHUK)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     105084316 (CHUK)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   105084316 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 105084316
NCBI-ProteinID: XP_010972733
LinkDB
Position
11
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHVNKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIVSFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPV
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMKEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPQVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQASAWLPPTSAEREHPLSCVVTPQDGETLAQMIEENLNCLGHL
STIIHEANEKQGNSLMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgagagcga
ctgggtacaggcggcttcgggaacgtctgcctataccagcatcgggaacttgatctcaaa
atagcaattaaatcttgtcgcctggagctcagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtgaaggcctgtgatgttcct
gaggaattgaattttttgattaatgatgtgcctcttctagcaatggagtattgttctgga
ggagatctccggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatataggatctgggatccgatatttgcatgtaaacaaaatt
atacatcgtgatttaaaaccagaaaatatagttcttcaggatgttggtggaaagattatg
cataaaattattgacctgggatacgccaaagatgttgatcaaggaagtctgtgtacatct
ttcgtgggaacattgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtgtttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagaaatgtcaggagaagttcgatttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgctg
aattgggatcctcagcagagaggaggacctgtcgatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagatagtttcttttttgttgccacctgatgagagtcttcattcactgcagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagcttctttcagagaccggaatt
tctctggatcctcgaaaaccagcctctcaatgtgttctggatggagtcaggggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccgtttgcttct
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagcttccagtt
atacagctgcgtaaagtatgggcggaagcagtgcactatgtgtctgggctaaaagaagac
tacagcaggctctttcagggacagagagcagcgatgttaagtcttcttagatataatgct
aacttgacaaaaatgaagaacactttgatctcagcatctcagcagctgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcatggaaagaaatgaaagaaaaggctatccac
tatgctgaggtcggtgtcattggatacttggaggatcagatcatgtctctgcacactgaa
atcatggagctacagaagagcccctatggacgacgtcagggagacttgatggaatctctg
gaacagcgcgccattgatctatataagcagttgaagcacagaccttcagatcactcctac
agcgacagcacggagatggtgaaaatcattgtgcatactgtgcagagtcaggaccgggtt
ctcaaagagctgtttggtcatctgagcaagttgttgggctgtaaacagaagattattgat
ctgctgccccaagtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccgatcccttgtaggatccagtctagaaggtgcagtaacccctcaggcctca
gcatggctgcctccaacttcagcagaacgtgaacatcctctgtcatgcgtggtaactcct
caagatggggagactttagcacaaatgatagaagagaatttgaactgtcttggccattta
agcactattattcatgaggcaaatgagaaacaaggcaatagtttgatgaatcttgattgg
agttggttaacagaatga

KEGG   Camelus dromedarius (Arabian camel): 105086448
Entry
105086448         CDS       T04642                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01523  Antifolate resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04068  FoxO signaling pathway
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04380  Osteoclast differentiation
cdk04620  Toll-like receptor signaling pathway
cdk04621  NOD-like receptor signaling pathway
cdk04622  RIG-I-like receptor signaling pathway
cdk04623  Cytosolic DNA-sensing pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04657  IL-17 signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04668  TNF signaling pathway
cdk04722  Neurotrophin signaling pathway
cdk04910  Insulin signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk05010  Alzheimer disease
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05145  Toxoplasmosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05212  Pancreatic cancer
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105086448 (IKBKB)
   04014 Ras signaling pathway
    105086448 (IKBKB)
   04064 NF-kappa B signaling pathway
    105086448 (IKBKB)
   04668 TNF signaling pathway
    105086448 (IKBKB)
   04068 FoxO signaling pathway
    105086448 (IKBKB)
   04151 PI3K-Akt signaling pathway
    105086448 (IKBKB)
   04150 mTOR signaling pathway
    105086448 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105086448 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105086448 (IKBKB)
   04621 NOD-like receptor signaling pathway
    105086448 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    105086448 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    105086448 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    105086448 (IKBKB)
   04660 T cell receptor signaling pathway
    105086448 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    105086448 (IKBKB)
   04659 Th17 cell differentiation
    105086448 (IKBKB)
   04657 IL-17 signaling pathway
    105086448 (IKBKB)
   04662 B cell receptor signaling pathway
    105086448 (IKBKB)
   04062 Chemokine signaling pathway
    105086448 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105086448 (IKBKB)
   04920 Adipocytokine signaling pathway
    105086448 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105086448 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105086448 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105086448 (IKBKB)
   05206 MicroRNAs in cancer
    105086448 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105086448 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105086448 (IKBKB)
   05221 Acute myeloid leukemia
    105086448 (IKBKB)
   05220 Chronic myeloid leukemia
    105086448 (IKBKB)
   05215 Prostate cancer
    105086448 (IKBKB)
   05222 Small cell lung cancer
    105086448 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105086448 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105086448 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105086448 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    105086448 (IKBKB)
   04931 Insulin resistance
    105086448 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105086448 (IKBKB)
   05135 Yersinia infection
    105086448 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105086448 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    105086448 (IKBKB)
   05161 Hepatitis B
    105086448 (IKBKB)
   05160 Hepatitis C
    105086448 (IKBKB)
   05171 Coronavirus disease - COVID-19
    105086448 (IKBKB)
   05164 Influenza A
    105086448 (IKBKB)
   05162 Measles
    105086448 (IKBKB)
   05168 Herpes simplex virus 1 infection
    105086448 (IKBKB)
   05163 Human cytomegalovirus infection
    105086448 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105086448 (IKBKB)
   05169 Epstein-Barr virus infection
    105086448 (IKBKB)
   05165 Human papillomavirus infection
    105086448 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105086448 (IKBKB)
   05142 Chagas disease
    105086448 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    105086448 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105086448 (IKBKB)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     105086448 (IKBKB)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   105086448 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Glyco_hydro_65m Med20
Other DBs
NCBI-GeneID: 105086448
NCBI-ProteinID: XP_031295889
LinkDB
Position
26
AA seq 754 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQSLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
TDIVVSEDLNGTVKFSSSLPYPNNLNSILAQRLEKWLQLMLTWHPRQRGTDPVYGPNGCF
KALDDILNLKLAHVLNMVTGTIHTYPVTEDESLQSLKARIQEDTGIAEEDQELLQEAGLA
LIPDKPAAQCISDGKLNEGRTLDMDLVFLFDNSRVTYETQVSPRPQPESVSCILQEPKRN
LPFFQLRRVWGQVWHSIQALKEDCSRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYNEQTEFGITSDKLQLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKMVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHPGQLMSQPCTAPDSEAVKKSEELVAEAHTLCTQLENA
LQDTMKEQDQSLRSLDWSWLQTAEEEQNGLEQAS
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgagctggtcgccttccctgccgacccagacatgtggggcctgggaaatgaaagagcgt
ctggggacagggggatttgggaacgtcatccgatggcacaatcaggaaacaggtgagcag
atcgctatcaagcagtgccggcaggagctcagtccccggaaccgagagcgatggtgcctg
gagatccagatcatgagaaggctgaaccaccccaacgtggtggccgcccgagacgtccct
gaggggatgcagagcctggcccccaacgacctgcccctgctggccatggagtactgccag
gggggcgacctgcgcaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcaccttgctgagtgacattgcctctgcgcttcgataccttcatgaaaacaga
atcatccatcgggatctgaagccagaaaacatcgtcctgcaacaaggggagcagaggtta
atacacaaaattattgacctcggatacgccaaggagctggatcagggcagtctctgtacg
tcctttgtggggaccctgcagtacctggctccggagctgctggagcagcagaagtacacg
gtcaccgttgactactggagcttcggcaccctggccttcgagtgcatcacgggcttccgg
cccttcctgcccaactggcagcccgtgcagtggcactccaaagtccggcagaagagcgag
acggacattgtggttagcgaagacctgaacgggacggtcaagttctcaagctctctaccc
taccccaacaacctcaacagcatcctggcgcagcggctggagaagtggctgcagctgatg
ctaacgtggcacccccggcagaggggcactgaccccgtctacgggcccaacggctgcttc
aaggccctggatgatatcttaaacttgaagctggctcatgtcttgaacatggtcacaggc
accattcacacctaccctgtgactgaggacgagagtctgcaaagcctgaaggccaggatc
caggaggacacgggcatcgccgaggaggaccaggagctgctgcaggaggcggggctggcc
ctgatccccgacaagcctgccgctcagtgcatctcagacggcaagctgaacgagggccgc
accctggacatggatctggtcttcctcttcgacaacagcagagtcacctacgagacccag
gtctcgccacggccccagcctgagagcgtcagctgcatcctccaagagcccaagaggaac
ctccccttcttccagctgcggagggtgtggggccaggtgtggcacagcatccaggccctg
aaggaggactgcagccgcctgcagcaggggcagcgagccgccatgatgaatctgctccgg
aacaacagctgcctgtccaagatgaagaactccatggcctccatgtcgcagcagctcaag
gccaagctggacttcttcaagaccagcatccagatcgacctggagaagtacaacgagcag
acggagttcggcatcacgtcagacaaactgcagctggcctggagggagatggagcaggcc
gtggagctctgcggacgggagaatgaggtgaagcacctggtggagcggatgatggcgctg
cagaccgacatcgtggacctgcagcgcagccccatgggccgcaagcagggcgggacgctg
gatgacctagaagagcaagcgagggagctttacaggaggctgagggagaaaccccgagac
cagcggactgatggtgacagtcaggaaatggtccggctgctccttcaggccatccagggc
tttgagaagaaagtgcgagtgatttacacgcagctcagcaaaacggtggtttgcaagcag
aaggccctggagttgctgcccaaggtggaggaggtggttagtctaatgaacgaagacgag
aagatggtggttcggcttcaggagaagcggcagaaggagctctggaacctcctgaagatc
gcgtgtagcaaggtccgtggtcctgtcagcggaagcccggacagcatgaacgcttctcgc
ctgagtcaccccggccagctgatgtcacagccctgcactgcccccgacagcgaggccgtc
aagaaaagcgaggagctggtggccgaagcgcacactctctgcacccagctagaaaatgca
ctgcaagacaccatgaaggagcaggaccagagcttaaggtctctagactggagctggtta
cagacggcggaggaggagcagaacggcctggagcaggcctcgtga

KEGG   Camelus dromedarius (Arabian camel): 105106603
Entry
105106603         CDS       T04642                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01523  Antifolate resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04380  Osteoclast differentiation
cdk04620  Toll-like receptor signaling pathway
cdk04621  NOD-like receptor signaling pathway
cdk04622  RIG-I-like receptor signaling pathway
cdk04623  Cytosolic DNA-sensing pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04657  IL-17 signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04668  TNF signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05145  Toxoplasmosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05212  Pancreatic cancer
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05340  Primary immunodeficiency
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105106603 (IKBKG)
   04014 Ras signaling pathway
    105106603 (IKBKG)
   04064 NF-kappa B signaling pathway
    105106603 (IKBKG)
   04668 TNF signaling pathway
    105106603 (IKBKG)
   04151 PI3K-Akt signaling pathway
    105106603 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105106603 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105106603 (IKBKG)
   04621 NOD-like receptor signaling pathway
    105106603 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    105106603 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    105106603 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    105106603 (IKBKG)
   04660 T cell receptor signaling pathway
    105106603 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    105106603 (IKBKG)
   04659 Th17 cell differentiation
    105106603 (IKBKG)
   04657 IL-17 signaling pathway
    105106603 (IKBKG)
   04662 B cell receptor signaling pathway
    105106603 (IKBKG)
   04062 Chemokine signaling pathway
    105106603 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105106603 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105106603 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105106603 (IKBKG)
   05203 Viral carcinogenesis
    105106603 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105106603 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105106603 (IKBKG)
   05221 Acute myeloid leukemia
    105106603 (IKBKG)
   05220 Chronic myeloid leukemia
    105106603 (IKBKG)
   05215 Prostate cancer
    105106603 (IKBKG)
   05222 Small cell lung cancer
    105106603 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    105106603 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105106603 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105106603 (IKBKG)
   05135 Yersinia infection
    105106603 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105106603 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    105106603 (IKBKG)
   05161 Hepatitis B
    105106603 (IKBKG)
   05160 Hepatitis C
    105106603 (IKBKG)
   05171 Coronavirus disease - COVID-19
    105106603 (IKBKG)
   05164 Influenza A
    105106603 (IKBKG)
   05162 Measles
    105106603 (IKBKG)
   05168 Herpes simplex virus 1 infection
    105106603 (IKBKG)
   05163 Human cytomegalovirus infection
    105106603 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105106603 (IKBKG)
   05169 Epstein-Barr virus infection
    105106603 (IKBKG)
   05165 Human papillomavirus infection
    105106603 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105106603 (IKBKG)
   05142 Chagas disease
    105106603 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    105106603 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105106603 (IKBKG)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   105106603 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1
Other DBs
NCBI-GeneID: 105106603
NCBI-ProteinID: XP_031302174
LinkDB
Position
X
AA seq 419 aa
MSRPPWKSQPSEMVQPSSGPAGDPDVLAEESSLGKPAMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRLQGSQREEKEFLMQKFQEARKLVERLSLEKVDLRRQKEQ
ALHEVERLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAAKERQALESRARAASEQ
ARQLESEREALQQRHSVQVDQLRMQNQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSGAVSSERSRGSQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRH
VEVSQAPLAPASTHHSFQLALPSQRRSPPEEPLNFCCPKCQYQAPDIDTLQIHVMECID
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggccgccctggaagagtcagccgagtgagatggtgcagcctagcagcggccca
gcaggggacccagacgtgctggctgaagagtcttctctggggaagccggccatgctccac
ctgccttcagagcagggcaccccggagaccttccagcgctgtctggaggagaatcaagag
ctccgagatgctatcaggcagagcaaccagatgctgcgggagcgctgtgaggagctgcag
cgtctgcagggcagccagcgggaggagaaggaattcctcatgcagaagttccaggaggcc
aggaagctggtggagagactgagcctggagaaggtggacctgcgccggcagaaggagcag
gccctgcatgaggtggagcgcctgaagcggtgccaacagcagatggccgaggacaaggcc
tcagtgaaggcgcaggtgacgtccctgctgggggagctccaggagagccagagtcgcctg
gaggccgccgccaaggagcggcaggctctggagagcagggcccgggcagccagcgagcag
gcccggcaactggagagtgagcgggaggcgctgcagcagcggcacagcgtgcaggtggac
cagctgcgcatgcagaaccagagcatggaggccgccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaggag
tacgacagccacatcaagagcggcgcggtgagcagcgagcggagcagaggatcgcagctg
gaagatctcaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaattg
atcgacaaactgaaggaagaggctgagcagcacaagatcgtgatggagacagttccagtc
ctgaaagcccaggcggatatctacaaggcggacttccaggctgagaggcaggcccgggag
aagctggctgagaagaaggagttcctgcaggagcagctggagcagctgcagagggagtac
agcaggttaaagaccagctgccaggaatcggccaggattgaagacatgaggaagcgacac
gtagaggtctcccaggcccccttagcccctgcctcgactcaccactcctttcaactggcc
ctgcccagccagaggagaagcccccctgaggagccactcaacttctgttgccccaagtgc
cagtatcaggcccctgacatagacaccctgcagatacacgtcatggagtgcatcgactag

DBGET integrated database retrieval system