KEGG   Camelus dromedarius (Arabian camel): 105084320Help
Entry
105084320         CDS       T04642                                 

Gene name
SCD
Definition
(RefSeq) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    105084320 (SCD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105084320 (SCD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105084320 (SCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdk01004]
    105084320 (SCD)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     105084320 (SCD)
Lipid biosynthesis proteins [BR:cdk01004]
 Desaturase
  First
   105084320 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 105084320
NCBI-ProteinID: XP_010972739
LinkDB All DBs
Position
11
AA seq 359 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGDKLEKTPLYLEEDIRPEMKDDIYDPSYQ
DKEGPKPKVVYVWRNIILMGLLHLGALYGITLIPTCKFYTFCWVLFYYIISALGITAGAH
RLWSHRSYKARLPLRVFLIIANTMAFQNDVFEWARDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGGLLDLSDLKAEKLVMFQRRYYKPGILLMCFIMPTLVPWYFWGE
TFQHSLYLATFLRYAVVLNVTWLVNSAAHLYGYRPYDKTINPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINPTTFFIDCMAALGLAYDRKKVSKAAILARVKRTGDGSYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaggaggagatctctagctcctacacaaccaccaccaccatc
acagcgcctccctccagggtcctgcagaatggaggcgacaagttggagaagactccccta
tacttggaagaagacatccgccctgaaatgaaagatgacatatatgacccaagctaccag
gataaggagggcccaaagcccaaggttgtgtatgtctggagaaacatcatcctcatgggt
ctgctgcatttgggagccctgtatgggatcacattgatccctacctgcaagttctacacc
ttctgctgggtgcttttctactatataataagtgccctgggcataacagcaggagctcat
cgcctgtggagtcaccgatcttataaagctcggctgccgttgcgggtcttcctgatcatt
gccaacaccatggcattccagaatgacgtttttgaatgggcccgagaccaccgcgcccac
cacaagttttcggaaacagatgctgatccccacaattcccgacgaggctttttcttctcg
cacgtgggttggctgcttgtgcgcaaacaccccgctgtcaaagagaaaggtggtttgcta
gacttgtctgacctaaaagccgagaagctggtgatgttccagaggaggtactataaaccc
ggcatcctgctgatgtgcttcatcatgcccacactcgtgccctggtatttctggggtgaa
acttttcaacacagcctgtaccttgccactttccttcgttacgccgttgtgctcaatgtc
acctggctggtgaacagtgctgctcacctgtacggatatcgcccttacgacaagactatt
aacccccgagagaatatcctggtttcactgggagctgtgggtgagggcttccacaactac
caccactcctttccctatgactactctgccagtgagtaccgctggcacatcaacccaacc
acgttcttcatcgattgcatggctgcccttggtctggcttatgaccggaagaaagtatcc
aaggctgccatcttggccagggttaaaagaactggagacggaagctacaagagtggctga

KEGG   Camelus dromedarius (Arabian camel): 105091895Help
Entry
105091895         CDS       T04642                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    105091895 (SCD5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105091895 (SCD5)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105091895 (SCD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdk01004]
    105091895 (SCD5)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     105091895 (SCD5)
Lipid biosynthesis proteins [BR:cdk01004]
 Desaturase
  First
   105091895 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 105091895
NCBI-ProteinID: XP_010981810
LinkDB All DBs
Position
2
AA seq 332 aa AA seqDB search
MPGPAADGGKAPFGNAKGEIRAGVGVEDSEGGGGRERPGARGQRQNIVWRNVVLMSLLHL
GAVYSLVLIPKAQPLTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSM
AFQNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSHVGWLFVRKHRDVIEKGRRLDFTD
LLADPVVRFQRKYYKITVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNVTWLV
NSAAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFI
DFMCWLGLATDRKRATKPMIEARKARTGDGSA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtccggccgccgacggggggaaggcccccttcggcaacgccaaaggggaaatc
cgtgcgggggtcggggtcgaggactcggagggcggcggcggccgggagaggcccggcgcg
cgcgggcagcggcagaacatcgtctggaggaacgtcgtcctgatgagcctgctccacttg
ggggccgtgtactccctggtgctcatccccaaagcccagccgctcactctgctctgggcc
tacttctgcttcctcctgactgctctgggtgtgacagctggtgcccatcgcttgtggagc
cacaggtcctacaaggccaagctgcctctgaggatatttctggctgccgccaactccatg
gctttccagaacgacatcttcgagtggtccagggaccaccgagtccaccacaagtactcg
gagacagatgctgacccccacaacgcccgccggggcttcttcttctcccacgtcgggtgg
ctgttcgtccgcaagcatcgggatgtcatcgagaaggggaggaggcttgacttcactgac
ctgctggctgatcccgtggtccggttccagagaaagtactacaagatcaccgtggtgctc
atgtgcttcgtggtccccacgctggtgccctggtacatctggggagagagtctgtggaat
tcctacttcctggcctccatcctccgctacaccatctcactcaacgtcacctggctggtc
aacagtgccgcccacatgtacggaaaccggccctatgacaagcacatcagccctcggcag
aacccgctcgtcaccctgggcgccattggtgaaggcttccataattatcatcacaccttt
ccctttgactactctgcaagtgaatttggcttaaatttcaacccaaccacctggttcatt
gacttcatgtgctggctgggactggccactgaccgcaaacgggccaccaagccgatgatc
gaggcccggaaagccaggactggagacggcagcgcctga

DBGET integrated database retrieval system