KEGG   Camelus dromedarius (Arabian camel): 105084321
Entry
105084321         CDS       T04642                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105084321 (WNT8B)
   04390 Hippo signaling pathway
    105084321 (WNT8B)
   04150 mTOR signaling pathway
    105084321 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105084321 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105084321 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105084321 (WNT8B)
   05205 Proteoglycans in cancer
    105084321 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105084321 (WNT8B)
   05226 Gastric cancer
    105084321 (WNT8B)
   05217 Basal cell carcinoma
    105084321 (WNT8B)
   05224 Breast cancer
    105084321 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105084321 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    105084321 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105084321 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105084321 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105084321 (WNT8B)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105084321 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105084321
NCBI-ProteinID: XP_031316607
LinkDB
Position
11
AA seq 335 aa
MPAFSNHHPDQSAVISIEAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHG
GLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNV
GFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWL
QLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYC
LENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWC
CAVRCEQCRRRVTKYFCSRAERPRGGAVHTPGRKP
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgccagccttcagcaaccaccaccctgatcagtcagcagtcatcagcatcgaggcttac
ctgatctactccagcagcgtggcagcaggtgctcagagtggtattgaagaatgcaaatac
cagtttgcctgggaccgctggaactgccctgagagagccctgcagctgtccagccatggc
ggccttcgcagtgctaatcgggagacagcatttgtacatgccatcagttctgctggggtc
atgtacactctgactagaaactgcagccttggggattttgacaactgtggctgtgatgac
tcccgcaatgggcaactggggggccaaggctggctgtggggaggctgcagcgacaacgtg
ggctttggagaggcaatatccaagcagttcgtcgatgccctggagacaggacaggatgcc
cgggcagccatgaacctacacaacaacgaggctggccgcaaggcggtgaagggcaccatg
aaacgcacgtgtaagtgtcatggcgtgtcaggtagctgcaccacgcagacctgctggctg
cagctgcccgagttccgcgaggtgggcgcacacctgaaagagaagtaccacgcagctctc
aaggtggacctgttgcagggtgctggtaatagcgcggccggccgcggcgccatcgccgac
acctttcgctccatctccacgcgggaactggtgcacctggaggactccccagactactgc
ctggagaacaaaacgcttggactgctgggcaccgaaggcagagagtgcttgcggcgcggc
cgggccctcggacgctgggaacgccgcagttgccgtcggctgtgcggggactgcgggctg
gcggtggaggagcgccgcgccgagacggtgtccagttgcaactgcaagttccactggtgc
tgcgcggtccgctgcgagcagtgccgtcggcgggtcaccaagtatttctgcagccgcgcg
gagcggccgcgggggggcgcggtgcacacacccgggagaaaaccctaa

KEGG   Camelus dromedarius (Arabian camel): 105085323
Entry
105085323         CDS       T04642                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105085323 (WNT2)
   04390 Hippo signaling pathway
    105085323 (WNT2)
   04150 mTOR signaling pathway
    105085323 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105085323 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105085323 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085323 (WNT2)
   05205 Proteoglycans in cancer
    105085323 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105085323 (WNT2)
   05226 Gastric cancer
    105085323 (WNT2)
   05217 Basal cell carcinoma
    105085323 (WNT2)
   05224 Breast cancer
    105085323 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105085323 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    105085323 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105085323 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105085323 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105085323 (WNT2)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105085323 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105085323
NCBI-ProteinID: XP_010973881
LinkDB
Position
7
AA seq 360 aa
MNARLGGIWLWLPLLLTWLSPEVSSSWWYMRAISGSAWVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLERDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIKDRDAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccgtctcggtggaatctggctttggctccctctgctcttgacctggctcagc
cctgaggtcagctcttcatggtggtacatgagagctataagtggctccgcctgggtgatg
tgtgacaatgtgccaggcctggtgagccgtcagcggcagctgtgccacagacacccagac
gtgatgcgtgccattggcctgggcgtggccgagtggacagcagagtgccagcaccagttt
cgccagcaccgctggaactgcaacaccctggagagggatcacagcctcttcggccgggtc
ttgctccgaagtagccgggaatctgcctttgtttacgccatctcctcagctggagttgtg
tttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgtgacccaaag
aagaagggaacggccaaagacagcaagggcactttcgactggggtggctgcagcgataac
attgactacgggatcaagtttgcccgtgcgtttgtggatgccaaggaaagaaaaggaaag
gatgccagggccctgatgaacttgcacaacaacagagctggcaggaaggctgtaaagcga
ttcttgaagcaggagtgcaagtgtcacggcgtgagcggctcatgtactctgaggacctgc
tggctggccatggccgacttcaggaaaacgggcgattatctctggaggaagtacaacggg
gccatccaggtcgtcatgaaccaggatggcactggtttcactgtggctaacaagaggttt
aaaaagccgacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcaag
gaccgagatgcaggctccctgggtacagcaggccgtgtgtgcaacctgacctcccgaggc
atggacagctgcgaagtcatgtgctgtgggagagggtatgacacctcccacgtcacccgg
atgaccaagtgtgagtgtaagttccactggtgctgtgctgtgcgctgtcaggactgcctg
gaggccctggatgtgcacacgtgcaaggcccctaagagcgccgactgggcagcccctaca
tga

KEGG   Camelus dromedarius (Arabian camel): 105085333
Entry
105085333         CDS       T04642                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105085333 (WNT16)
   04390 Hippo signaling pathway
    105085333 (WNT16)
   04150 mTOR signaling pathway
    105085333 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105085333 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105085333 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085333 (WNT16)
   05202 Transcriptional misregulation in cancer
    105085333 (WNT16)
   05205 Proteoglycans in cancer
    105085333 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105085333 (WNT16)
   05226 Gastric cancer
    105085333 (WNT16)
   05217 Basal cell carcinoma
    105085333 (WNT16)
   05224 Breast cancer
    105085333 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105085333 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    105085333 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105085333 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105085333 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105085333 (WNT16)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105085333 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105085333
NCBI-ProteinID: XP_010973898
LinkDB
Position
7
AA seq 362 aa
MDRAALLGLSRLCALWAALLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KKKPYLLPSIREGARLGIQECRSQFKHERWNCLVTVTAQPGTSPLFGYELSSGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFL
DFPIRNTTGKESKVLLAMNLHNNEAGRQAVAKLMSLDCRCHGVSGSCAVKTCWKTMSSFE
KIGHLLKDKYENSIQISDKIKRKMHRREKDQKKIPIHKDDLLYVNKSPNYCVEDKKLGIP
GTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggacagagccgcgctcctgggactgtcccgcctgtgcgcgctgtgggcagccctgctc
gcgctgttcccttgcggagcccagggaaactggatgtggttgggcattgcctcctttggg
gtcccggagaagctgggttgcgccaacttgccgctgaacagccgccagaaggagctgtgc
aagaagaaaccgtacctgctgccgagcatccgcgagggcgcccggctgggtattcaggag
tgcaggagccagttcaaacacgagagatggaactgcctggtgaccgtcaccgcccagcct
ggcaccagccctctctttggctacgagctgagcagcggcaccaaggagactgcatttatt
tatgccgtgatggccgcaggcctggttcattctgtgaccaggtcatgcagtgcaggcaac
atgaccgagtgttcctgtgacaccaccttgcagaacggcggctcggcgagtgaaggctgg
cactgggggggctgctctgatgatgtccagtatggcatgtggttcagcagaaagttccta
gatttccccatcagaaacaccaccggaaaagaaagcaaagtactattagcaatgaaccta
cataacaatgaagctggaaggcaggctgtcgccaagttgatgtctttagactgccggtgt
catggagtttctggctcctgtgctgtgaaaacatgctggaaaaccatgtcttcttttgaa
aaaattggccatctgttgaaggataaatatgaaaacagtatccaaatctcagacaaaata
aagaggaaaatgcacagaagagaaaaagatcagaagaaaataccgatccataaggatgat
ctgctctacgttaataagtctcccaattactgtgtagaggataagaaactagggatccca
gggactcaaggcagagagtgcaaccgcacgtcagagggtgcagacggctgcaacctcctc
tgctgtggccgcggctacaacacccacgtggtcaggcacgtggagagatgcgagtgcaag
tttatctggtgctgctacgtccgctgcaggaggtgtgaaagcatgactgatgtccacact
tgcaagtga

KEGG   Camelus dromedarius (Arabian camel): 105088869
Entry
105088869         CDS       T04642                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04360  Axon guidance
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04919  Thyroid hormone signaling pathway
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105088869 (WNT4)
   04390 Hippo signaling pathway
    105088869 (WNT4)
   04150 mTOR signaling pathway
    105088869 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105088869 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    105088869 (WNT4)
   04916 Melanogenesis
    105088869 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    105088869 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105088869 (WNT4)
   05205 Proteoglycans in cancer
    105088869 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105088869 (WNT4)
   05226 Gastric cancer
    105088869 (WNT4)
   05217 Basal cell carcinoma
    105088869 (WNT4)
   05224 Breast cancer
    105088869 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105088869 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    105088869 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105088869 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105088869 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105088869 (WNT4)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105088869 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105088869
NCBI-ProteinID: XP_031320165
LinkDB
Position
13
AA seq 296 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAI
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRER
NKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALK
EKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRT
CNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtgcaagcggaacctggaggtgatggactcggtgcgccgcggcgcccagctcgccatc
gaggagtgccagtaccagttccggaaccggcgctggaactgctccacgctcgactcgctg
cctgtctttggcaaggtggtgacgcaagggactcgggaggcggccttcgtgtacgccatc
tcttcggcaggtgtggccttcgcggtgacgcgggcatgcagcagcggggagcttgaaaag
tgcggctgtgaccggacggtacatggggtcagcccacagggcttccagtggtcaggatgc
tcggacaacattgcctacggtgtggccttctcacagtcgttcgtggacgtgcgggagaga
aacaagggggcctcgtccagccgggccctcatgaacctgcacaacaacgaggccggcagg
aaggctatcctgacacacatgcgggtggagtgcaagtgccacggggtgtcgggctcctgc
gaggtaaagacgtgctggcgagccgtgccgcccttccgccaggtgggccatgcactcaag
gagaagtttgatggagccaccgaggtggagccacgccgtgtgggctcctccagggcactg
gtgccgcgtaacgcgcagttcaagccacacacagatgaggacctggtgtacttggagccc
agcccagacttctgtgagcaggacatgcgcagcggcgtgctgggcacgaggggccgcacg
tgcaacaagacatccaaggccatcgacggctgtgagctgctgtgctgcggccgtggcttc
cacacagcacaggtagagctagctgagcgctgcagctgcaaattccactggtgctgcttc
gtcaagtgccggcagtgccagcgcctcgtcgagctgcacacgtgccggtga

KEGG   Camelus dromedarius (Arabian camel): 105089783
Entry
105089783         CDS       T04642                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X2
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04360  Axon guidance
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105089783 (WNT5A)
   04390 Hippo signaling pathway
    105089783 (WNT5A)
   04150 mTOR signaling pathway
    105089783 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105089783 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105089783 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    105089783 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105089783 (WNT5A)
   05205 Proteoglycans in cancer
    105089783 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105089783 (WNT5A)
   05226 Gastric cancer
    105089783 (WNT5A)
   05217 Basal cell carcinoma
    105089783 (WNT5A)
   05224 Breast cancer
    105089783 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105089783 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    105089783 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105089783 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105089783 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105089783 (WNT5A)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105089783 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105089783
NCBI-ProteinID: XP_010979196
UniProt: A0A5N4CYD4
LinkDB
Position
17
AA seq 380 aa
MKKSIGILSPGVALGTAGRAMSSKFFLMALAIFISFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtcgattggaatattaagcccaggagttgctttggggacggctggaagggca
atgtcttccaagttcttcctaatggctttggccatatttatctccttcgcccaggttgta
atagaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggagcgcagcctctctgcagccaactggcaggactttctcaaggacaaaag
aaactatgccacttgtatcaggaccacatgcagtacatcggagagggtgcgaagacaggc
atcaaagagtgccagtatcaattccgacaccggcggtggaactgcagcaccgtggataac
acctccgtctttggcagggtcatgcagataggcagccgcgagacggccttcacatacgcg
gtgagcgccgcgggggtggtcaacgccatgagccgcgcgtgccgggagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctgtggggc
ggctgcggcgacaacattgactacggctaccgcttcgccaaggagtttgtggacgcgcgc
gagcgggagcgcatccacgccaagggctcgtacgagagcgcgcgcatcctcatgaacctg
cacaacaacgaggccggccgccggacggtgtacaacctggctgacgtggcctgcaagtgc
catggggtgtcgggctcatgcagcctcaagacgtgctggctgcagctggccgacttccgc
aaggtgggcgacgccctgaaggagaagtatgacagcgcagcggccatgcggctcaacagc
cggggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacacaggacctggtc
tacatcgaccccagccccgactactgcgtgcgcaacgagagcaccggctcgctgggcaca
cagggccgcctgtgcaacaagacatccgagggcatggacggctgcgagctcatgtgctgc
ggccgcggctacgaccagttcaagacggtgcagaccgagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagattgtggaccagttcgtgtgcaaa
tag

KEGG   Camelus dromedarius (Arabian camel): 105090437
Entry
105090437         CDS       T04642                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3 isoform X2
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105090437 (WNT3)
   04390 Hippo signaling pathway
    105090437 (WNT3)
   04150 mTOR signaling pathway
    105090437 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105090437 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105090437 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105090437 (WNT3)
   05206 MicroRNAs in cancer
    105090437 (WNT3)
   05205 Proteoglycans in cancer
    105090437 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105090437 (WNT3)
   05226 Gastric cancer
    105090437 (WNT3)
   05217 Basal cell carcinoma
    105090437 (WNT3)
   05224 Breast cancer
    105090437 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105090437 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    105090437 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105090437 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105090437 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105090437 (WNT3)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105090437 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105090437
NCBI-ProteinID: XP_010980060
LinkDB
Position
16
AA seq 355 aa
MEPHLLGLLLGLLLCGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctctgtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacgtccctgggctca
cagcccctgctctgtggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgaaatcatgcccagtgtggctgagggtgtgaagctgggcatccaggagtgc
cagcaccagttccgaggccgccgctggaactgcaccaccattgacgacagcctggccatc
ttcgggcccgtcctcgacaaagccacccgcgaatcagcctttgtgcatgccatcgcctca
gctggggtggcctttgctgtcacacgctcctgtgccgagggcacctccaccatctgtggc
tgtgattcgcatcataaggggccgcctggagagggctggaagtggggcggctgcagtgag
gacgccgacttcggggtgctcgtgtctcgggagtttgccgacgcacgcgagaacaggccg
gatgcccgctcggctatgaacaagcacaacaacgaggctggccgcacgaccatcctggac
cacatgcacctcaagtgcaagtgccatggactgtcaggcagctgcgaggtcaagacctgc
tggtgggcccagcccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagc
gcctcagagatggtggtggagaagcaccgggagtcccgcggctgggtggagaccctccgt
gccaagtacgcactcttcaagccacccacggagcgggacctggtctactacgagaactcc
cccaacttttgcgagcccaaccccgagacgggctcctttggcaccagggaccggacttgc
aatgtcacctcccacggcatcgatggctgtgacctgctctgctgcggccgcggccacaac
acaaggacggagaagcgcaaggagaaatgccactgcatcttccactggtgctgctatgtg
agctgccaggagtgcatccgcatctacgacgtgcacacctgcaagtag

KEGG   Camelus dromedarius (Arabian camel): 105090501
Entry
105090501         CDS       T04642                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105090501 (WNT9B)
   04390 Hippo signaling pathway
    105090501 (WNT9B)
   04150 mTOR signaling pathway
    105090501 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105090501 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105090501 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105090501 (WNT9B)
   05205 Proteoglycans in cancer
    105090501 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105090501 (WNT9B)
   05226 Gastric cancer
    105090501 (WNT9B)
   05217 Basal cell carcinoma
    105090501 (WNT9B)
   05224 Breast cancer
    105090501 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105090501 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    105090501 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105090501 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105090501 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105090501 (WNT9B)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105090501 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105090501
NCBI-ProteinID: XP_031324637
LinkDB
Position
16
AA seq 367 aa
MRQGAARRHHAPQPALALAALCLLALPAAAAAAYFGLTGREVLTPFPGLGTAAAPAQGGA
HLKQCDLLKLSRRQKQLCRREPGLAETLQDAAHLSLLECQFQFRHERWNCSLEGRTGLLK
RGFKETAFLYAVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYST
KFLNNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSP
FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPAKPGSPTKGLAPRPGDLVYMEDSPSF
CRPSKYSPGTAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEE
LVYTCKH
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcgacagggcgccgcccgccggcatcatgcgccccagcccgcgctggccctggccgcg
ctctgcctgctggcgctgcccgccgccgccgccgccgcctacttcggcttgactgggcgg
gaggtcctgacgcccttcccggggctgggcaccgccgctgccccggcacaaggtggggcc
cacctgaagcagtgtgacctcctgaagctgtcccgccggcaaaagcagctctgtcggagg
gagccaggcctggctgagaccctgcaggacgctgcacacctcagcctgctcgagtgccag
tttcagttccggcatgagcgctggaactgcagcctggaagggaggacagggctgctcaag
agaggtttcaaggagacggcctttctgtacgcggtgtcttcggctgccctcacccacacc
ctggcccgggcctgcagcgccgggcgcatggagcgttgcacctgcgatgactctccaggc
ctggagagccggcaggcctggcagtggggtgtgtgtggcgacaatctcaagtatagcaca
aagttcctgaacaacttcctggggcccaagagaggaagcaaagacctgcgggcacgggca
gacgcccacaacacccacgtggggatcaaggctgtgaagagtggcctcaggaccacgtgt
aagtgccatggtgtgtcaggctcctgtgctgtgcgcacctgctggaagcagctctcccca
ttccgtgagacaggccaggtgttgaagctgcgctacgactcagctgtcaaggtgtccagt
gccaccaacgaggccttgggccgcctggagctgtgggcacctgccaagccgggcagcccc
accaagggcctggccccgcggcctggggacctggtctacatggaggactcacccagtttc
tgccggcccagcaagtactcccctggcactgcgggcagggtgtgctcccgggaggccagc
tgcagtagcctgtgctgcgggcggggctacgacacccagagccgcctggtggccttctcc
tgccactgccaggtgcagtggtgctgctacgtggagtgccagcagtgtgtgcaggaggag
cttgtgtatacctgtaagcactag

KEGG   Camelus dromedarius (Arabian camel): 105090590
Entry
105090590         CDS       T04642                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105090590 (WNT8A)
   04390 Hippo signaling pathway
    105090590 (WNT8A)
   04150 mTOR signaling pathway
    105090590 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105090590 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105090590 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105090590 (WNT8A)
   05205 Proteoglycans in cancer
    105090590 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105090590 (WNT8A)
   05226 Gastric cancer
    105090590 (WNT8A)
   05217 Basal cell carcinoma
    105090590 (WNT8A)
   05224 Breast cancer
    105090590 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105090590 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    105090590 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105090590 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105090590 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105090590 (WNT8A)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105090590 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105090590
NCBI-ProteinID: XP_010980245
UniProt: A0A5N4ED44
LinkDB
Position
3
AA seq 352 aa
MGDLFMLRVAVGIYYATFSASAWSVNNFLITGPKAYLTYATSVALGAQSGIEECKFQFAW
ERWNCPENVLQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLANFREMGDYLKAKYDRALKIEMDKRRLRSGNSAEGHWTPTEA
FLPSAEAELIFLEESPDYCTRNSSLGIYGTEGRECLQNSHNTSRWERHSCGRLCTECGLR
VEERRTEAISSCNCKFQWCCTVKCDQCRHVVNKYYCTRSSSSAWSWDKSDKR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggtgacctgtttatgctcagggtggctgtgggcatatactatgccaccttcagtgcc
tctgcctggtcagtgaacaatttcctgataacaggtcccaaggcttatctgacctacgct
accagtgtggccttgggtgcccagagtggcatcgaggagtgtaagttccaatttgcttgg
gaacgctggaactgccctgaaaatgttctccagctctctactcacaacaggctgagaagt
gccaccagggagacttccttcattcatgctatcagctctgctggagtcatgtacaccatc
accaagaattgtagcatgggcgattttgaaaactgtggctgtgatgaatcaaaaaatgga
aaaacaggaggccatggctggatctggggaggctgcagtgacaatgtagaatttggagaa
agaatctccaaactttttgtggacagcctggagaaggggaaggatgccagagccctgatg
aatcttcacaataacagggcaggcaggctggcagtgagagccaccatgaaaaggacctgc
aaatgtcatggcatctcggggagttgcagcatccagacatgctggctgcagctggctaac
ttccgggagatgggtgattacctaaaggccaagtatgatagggcactgaaaattgagatg
gataagcggcgactgaggtctgggaacagtgccgagggccactggacacctactgaggcc
ttccttcccagcgcagaagctgagctgatctttttagaggaatcacctgattactgtacc
cgcaattccagcctgggcatctatggcactgagggtcgggagtgtctgcagaacagccac
aacacatccaggtgggagcgacatagctgcgggcgcttgtgcactgagtgtggcctgcgt
gtggaagagaggagaactgaggctatcagcagctgtaactgcaaattccagtggtgctgt
acagtcaagtgtgaccagtgtaggcatgtggtgaataagtactactgcacgcgctcctca
agcagtgcttggtcttgggacaagagtgacaagcgatag

KEGG   Camelus dromedarius (Arabian camel): 105091978
Entry
105091978         CDS       T04642                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105091978 (WNT7B)
   04390 Hippo signaling pathway
    105091978 (WNT7B)
   04150 mTOR signaling pathway
    105091978 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105091978 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105091978 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105091978 (WNT7B)
   05205 Proteoglycans in cancer
    105091978 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105091978 (WNT7B)
   05226 Gastric cancer
    105091978 (WNT7B)
   05217 Basal cell carcinoma
    105091978 (WNT7B)
   05224 Breast cancer
    105091978 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105091978 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    105091978 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105091978 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105091978 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105091978 (WNT7B)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105091978 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105091978
NCBI-ProteinID: XP_031319295
LinkDB
Position
12
AA seq 356 aa
MAQTPSLDHAQKLSQVDFLRVSLLWRSLREARSAVVRRGLGSQHHLQQDPRLGPTAARHL
PEPARCHHRDRGGGPDGHQRVPVPVPLRTLELLCPRREDRLWARAPRSREAAFTYAITAA
GVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIK
KNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYN
VAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRL
CNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcgcagaccccctccctggatcatgcacagaaactttcgcaagtggattttctacgt
gtttctctgctttggcgttctttacgtgaagctcggagcgctgtcgtccgtcgtggcctt
gggagccaacatcatctgcaacaagatccccggcttggccccacggcagcgcgccatctg
ccagagccggcccgatgccatcatcgtgatcggggagggggcccagatgggcatcaacga
gtgccagtaccagttccgcttcggacgctggaactgctctgccctcggcgagaagaccgt
ctttgggcaagagctccgaggagccgtgaggcggccttcacgtacgccatcaccgcagcc
ggcgtggcccacgccgtcaccgccgcctgcagccagggcaacctgagcaactgcgggtgc
gatcgcgagaagcagggctactacaaccaggccgagggctggaagtggggcggctgctcc
gccgacgtgcgctacggcatcgacttctcccgccgtttcgtggacgcccgcgagatcaag
aaaaacgccaggcgcctgatgaacctgcacaacaacgaggccggcaggaaggtcctggag
gagcgcatgaagctggagtgtaagtgccacggtgtgtcgggctcctgcaccaccaagacc
tgctggaccacgctgcccaagttccgcgaggtgggccacctgctgaaggagaagtacaac
gtggcggtgcaggtggaggtggtgcgggccagccgcctgcggcagcccaccttcctgcgc
atcaaacagctgcgcagctaccagaagcccatggagacggacctggtgtacatcgagaag
tcgcccaactactgcgaggaggacgcggccaccggcagcgtgggcacgcagggccgcctc
tgcaaccgcacctcccccggcgccgacggctgcgacaccatgtgctgcggccgcggctac
aacacccaccagtacaccaaggtctggcagtgcaactgcaagttccactggtgctgcttc
gtcaagtgcaacacgtgcagcgagcgcaccgaggtcttcacctgcaagtga

KEGG   Camelus dromedarius (Arabian camel): 105093166
Entry
105093166         CDS       T04642                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105093166 (WNT7A)
   04390 Hippo signaling pathway
    105093166 (WNT7A)
   04150 mTOR signaling pathway
    105093166 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105093166 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105093166 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105093166 (WNT7A)
   05205 Proteoglycans in cancer
    105093166 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105093166 (WNT7A)
   05226 Gastric cancer
    105093166 (WNT7A)
   05217 Basal cell carcinoma
    105093166 (WNT7A)
   05224 Breast cancer
    105093166 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105093166 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    105093166 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105093166 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105093166 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105093166 (WNT7A)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105093166 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 105093166
NCBI-ProteinID: XP_031326865
LinkDB
Position
17
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggcggcttctcctcagtggtagctctgggcgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctcggcgctgggggagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgccttcacctacgccatcatcgcggccggcgtggcccacgccatcacc
gcggcctgtacccagggcaacctgagcgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctatggcatc
ggcttcgccaaggtttttgtggatgcacgggagatcaagcagaacgcccggaccctcatg
aacttacacaataacgaggcgggccgaaagatcctggaggagaacatgaagctggagtgc
aagtgccacggcgtgtcgggctcctgcaccaccaagacctgctggaccacgctgccccag
ttccgggagctgggctacgtgctcaaggacaagtacaacgaggcggtccacgtggagccc
gtgcgcgccagccgcaacaagcggcccaccttcctgaagatcaagaagccgctgtcctac
cgcaagcccatggacacagacttggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgacgggcagcgtgggcacgcagggccgcgcctgcaacaagacggccccccag
gccagcggctgcgacctcatgtgctgcggccgcggttacaacacccaccagtacgcccgc
gtgtggcagtgcaactgcaagttccactggtgctgctacgtcaagtgcaacacgtgcagc
gagcgcaccgaggtctacacctgcaagtga

KEGG   Camelus dromedarius (Arabian camel): 105094160
Entry
105094160         CDS       T04642                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105094160 (WNT3A)
   04390 Hippo signaling pathway
    105094160 (WNT3A)
   04150 mTOR signaling pathway
    105094160 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105094160 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105094160 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105094160 (WNT3A)
   05206 MicroRNAs in cancer
    105094160 (WNT3A)
   05205 Proteoglycans in cancer
    105094160 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105094160 (WNT3A)
   05226 Gastric cancer
    105094160 (WNT3A)
   05217 Basal cell carcinoma
    105094160 (WNT3A)
   05224 Breast cancer
    105094160 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105094160 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    105094160 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105094160 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105094160 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105094160 (WNT3A)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105094160 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105094160
NCBI-ProteinID: XP_031305343
LinkDB
Position
3
AA seq 352 aa
MAPLGYFIFLYGLKQALGNYPIWWSLAVGPQYSSLGTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGVKISIQECQHQFRGRRWNCTTINDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSGRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTEGDLVYYEASPNFCEPNAETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECARVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccccgctcggatatttcatattcctctacggcctgaagcaagcgctgggcaactac
ccgatctggtggtccctggctgtcgggccccagtactcatccctgggcacgcagcccatc
ctctgcgccagcatccccggtctggtacccaagcagctgcgcttctgccggaactacgtg
gagatcatgcccagcgtggcagagggcgtcaagatcagcatccaggaatgccaacaccag
ttccgcggccgccgctggaactgcaccaccatcaacgacagcctggccatctttggccct
gtgctggacaaagccacccgggagtccgccttcgtgcacgccatcgcctccgccggcgtc
gccttcgctgtgacacgctcgtgcgccgagggctcggctgccatctgcggctgcagcggc
cgccaccagggttcgccgggcgagggctggaagtggggcggctgcagcgaggacatcgag
ttcggcgggatggtgtctcgggagttcgcagacgctcgggagaaccggccggatgctcgc
tccgcgatgaaccgccacaacaatgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgtaagtgccacgggctgtcgggcagctgtgaggtgaagacctgctggtggtcg
cagcccgacttccgtgccattggtgacttcctcaaggacaagtacgacagcgcctcggaa
atggtggtggaaaagcaccgcgagtcgcgcggctgggtggagaccctgcggccacgctac
acctacttcaaagtgcccaccgagggcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaacgccgagaccggatccttcggcacgcgcgaccgcacctgcaatgtgagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgcacc
gagcggcgcagggagaagtgccactgcgtcttccactggtgctgctacgtgagctgccag
gagtgcgcgcgcgtttacgacgtgcacacctgcaagtag

KEGG   Camelus dromedarius (Arabian camel): 105094161
Entry
105094161         CDS       T04642                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105094161 (WNT9A)
   04390 Hippo signaling pathway
    105094161 (WNT9A)
   04150 mTOR signaling pathway
    105094161 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105094161 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105094161 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105094161 (WNT9A)
   05205 Proteoglycans in cancer
    105094161 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105094161 (WNT9A)
   05226 Gastric cancer
    105094161 (WNT9A)
   05217 Basal cell carcinoma
    105094161 (WNT9A)
   05224 Breast cancer
    105094161 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105094161 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    105094161 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105094161 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105094161 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105094161 (WNT9A)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105094161 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 105094161
NCBI-ProteinID: XP_031298124
LinkDB
Position
3
AA seq 579 aa
MARLRKRRGITCWPVSLCTQTSPGSRADARSPALRLTPESPAAPPPGVGAKSSALAPPQA
TPRPLGRSESPTPRSPNAPTSCSHPACRPTPRPRRLAPGRQRSASSPPLQPPRGSFRSPG
PQRAPAPPLRPPPGSTPPACLLRGARPNRVAGATRQGRSSWLGFRRPGGVTLGAGGAGQL
AGPAPGLARGYKRAAARGPCAGLGARWSAAAARQDAGWAPAGAWLAAAFALTLLLPRVRP
SAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAV
SMSALECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRM
ERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKV
IKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKRLKHKYETALKVGSTTNEATGEAGA
ISPPRGRASGTGGGDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGR
GHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggccaggcttcgcaaacggcggggcatcacctgctggcctgtctccctttgcacgcag
acttctccggggagccgagctgacgcgcgctctcccgctcttcggctgacaccggagtcc
cctgcggcaccacctcctggcgtcggggccaagagctccgccctggccccgccccaggcc
acaccccgcccccttggccgctccgagtcccccacccccagatcccctaacgctcccacc
tcttgctcccaccccgcctgtcgcccaacgccccgcccccgccgtcttgccccaggccgt
caacgctccgcctcgtctccgcccctacagccgcccaggggctcgttccgttcccccggc
ccccaacgcgcccccgcccctcctcttcggcccccgcccgggtccaccccgcctgcgtgc
ctcctccggggggcgcgcccaaaccgagtggcgggtgcgacgaggcaggggcggtcgagt
tggctcgggtttcggcgcccgggcggcgtgaccctcggggcgggcggggcgggccagctg
gcgggccccgcccccggcctggctcggggctataagagggcggcggcgcgggggccctgc
gcggggctgggagcgcgatggtcagccgccgcggcgcggcaagatgctggatgggcccct
gctggcgcgtggctggccgcggccttcgcgctgacgctgctgctgccgcgcgtgcgcccc
tcggccgcctacttcgggctgacgggcagcgagcccttgaccatcctcccgctgaccctg
gagccggaagcagccgcgcaggcgcactataaggcgtgcgaccgactgaagctggagcgc
aagcagcggcgcatgtgccgccgggacccgggcgtggccgagacgctggtggaggcggtc
agcatgagcgccctcgagtgccagtaccagttccgctttgagcgctggaactgcaccctg
gagggccgctaccgggccagcctgctcaagcgcggcttcaaggagactgccttcctctat
gccatctcctccgcgggcctgacccatgcgctggccaaggcgtgcagtgcaggccgcatg
gagcgctgcacttgtgatgaggcccctgacctggagaaccgggaggcctggcagtggggt
ggctgcggggacaacctcaagtacagcagcaagttcgtcaaggagttcctgggccggcgg
tcgagcaaggatctgcgagcccgtgtggacttccacaacaacctcgtgggtgtgaaggtg
atcaaggccggggtggagaccacgtgcaagtgccatggcgtgtcaggctcgtgcactgtg
aggacgtgctggcggcagctggcacctttccacgaggtgggcaagcgcctgaagcacaag
tacgagacggcgctcaaggtgggcagcaccaccaacgaggccaccggcgaggctggcgcc
atctcaccaccaaggggccgggcctcagggacgggtggcggcgacccgctaccccgcacc
ccggagctagtgcacctggacgactcacccagcttctgcctggctggccgcttctccccg
ggcactgctggccgcaggtgccaccgcgagaagaactgtgagagcatctgctgcgggcgc
ggccacaacacacagagccgagtggtgacccggccctgccagtgccaggtgcgctggtgc
tgctacgtggagtgcaggcagtgcacccagcgcgaggaggtctacacctgcaagggctga

KEGG   Camelus dromedarius (Arabian camel): 105096131
Entry
105096131         CDS       T04642                                 

Gene name
WNT6
Definition
(RefSeq) LOW QUALITY PROTEIN: protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105096131 (WNT6)
   04390 Hippo signaling pathway
    105096131 (WNT6)
   04150 mTOR signaling pathway
    105096131 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105096131 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105096131 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105096131 (WNT6)
   05205 Proteoglycans in cancer
    105096131 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105096131 (WNT6)
   05226 Gastric cancer
    105096131 (WNT6)
   05217 Basal cell carcinoma
    105096131 (WNT6)
   05224 Breast cancer
    105096131 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105096131 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    105096131 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105096131 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105096131 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105096131 (WNT6)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105096131 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105096131
NCBI-ProteinID: XP_031308053
LinkDB
Position
5
AA seq 376 aa
MPASARPRAVTMLPPAPSRLGLLLXLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAG
RQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVF
AITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPPGLPGTPGPPGPAGSPDGSAAWEW
GGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSG
SCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAAD
SPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCV
VQCHRCRVRKELSLCL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcccgcatcggcccgccctagagctgtcacgatgctgccgcccgcgccttcccgcttg
gggctgcttctgncgcttctcctgtgtccggcgcacgtcggcggactgtggtgggcagtg
ggcagccccttggtcatggaccctaccagcatctgcaggaaggcacggcggctggcaggg
cggcaggctgagttgtgccaggcagagccggaagtggtggccgagctagcccggggcgcc
cggctaggggttcgagaatgccagttccagttccgtttccgccgatggaactgctccagc
cacagcaaagccttcgggcgcatcctgcagcaggacatccgggagacggccttcgtgttt
gctataacggctgcaggagccagccacgcggtcacgcaggcctgttccatgggcgagctg
ctgcagtgcggctgccaggcgccccgtggccgggccccgccccgcccccccggcctgcca
gggacccctgggcctcctggtccagcgggctcccccgacggcagcgccgcctgggagtgg
ggaggctgtggcgacgacgtggacttcggggacgagaagtcaaggctctttatggacgcg
cagcacaagcggggtcggggagacatccgtgccttggtgcaacttcacaacaacgaggca
ggccgtctggcggtgcggagccacacgcggaccgagtgcaagtgccacgggctgtcgggc
tcatgcgcgttgcgcacctgctggcagaagctgcccccgttccgtgaggtgggcgcgcgg
ctgctcgagcgcttccacggagcctctcgggtcatgggtaccaacgacggcaaggctctg
ctgcccgccgtccgcacgctcaaaccgccgggtcgcgctgacctactctacgccgccgac
tcgcccgacttctgcgcccccaacaggcgcacaggttcgcccggcacgcgcggccgcgcc
tgcaacagcagcgccccggacctcagcggctgcgacctgctctgctgcggccgcgggcac
cgccaggagagcgtgcagctcgaggagaactgcctgtgccgcttccactggtgctgcgta
gtgcagtgccaccgctgccgcgtgcgcaaggaactcagcctctgcctctga

KEGG   Camelus dromedarius (Arabian camel): 105096132
Entry
105096132         CDS       T04642                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105096132 (WNT10A)
   04390 Hippo signaling pathway
    105096132 (WNT10A)
   04150 mTOR signaling pathway
    105096132 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105096132 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105096132 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105096132 (WNT10A)
   05205 Proteoglycans in cancer
    105096132 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105096132 (WNT10A)
   05226 Gastric cancer
    105096132 (WNT10A)
   05217 Basal cell carcinoma
    105096132 (WNT10A)
   05224 Breast cancer
    105096132 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105096132 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    105096132 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105096132 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105096132 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105096132 (WNT10A)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105096132 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 105096132
NCBI-ProteinID: XP_031308052
LinkDB
Position
5
AA seq 417 aa
MGSTHPCPWLRLRPRPQPRPALCALLFFLLLLAAAVPRSASNDILGLRLPQEPVLNANTV
CLTLPGLSKRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAISAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLE
ALQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGVPGPRRRASPTDLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcacccacccttgcccctggctgcggctccgacctcggccccagccgcggccc
gcgctctgcgcgctgctcttcttcctactgctgctggctgccgctgtgcccaggtctgca
tccaacgatattctgggcctccgcctcccccaggagcccgtgctcaacgccaacacggtg
tgcctgacgttgccgggactgagcaagcggcagatggaggtgtgtgtgcgccaccctgat
gtggctgcctcggccatccagggcatccagattgccatccacgagtgccagcaccagttc
cgggaccaacgctggaactgctctagtctcgagacccgaaacaagatcccctatgaaagt
cccatcttcagcagaggtttccgagagagtgccttcgcctacgccatctccgcagcgggt
gtggtgcatgcggtatccaatgcctgcgccctaggcaaactgagggcttgcggctgcgac
gcgtcccggcgtggggacgaggaggccttccgtcgaaagttgcaccgcctgcagctggag
gcgctgcaacgcggaaagggcctgagccacggagttccggagcacccagccctgccccct
gccagcccgggcctgcaggactcctgggagtggggaggctgcagccccgacgtgggtttt
ggagagcgcttctctaaagactttctggactcccgggagcctcacagagacatccatgca
cgtatgaggctccacaacaaccgagtggggaggcaggcagtgatggagaacatgcggcgg
aagtgcaagtgccacgggacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
ccggagttccgcgcggtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagcccggccccgcgggggcaccttcgcca
gccccgggtgtcccagggccacggcgccgcgccagccccaccgacctggtctacttcgag
aagtcgcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgcgggtcccgacggctgcggcagcatgtgctgtggccgcggc
cacaacatcctacgccagacgcgcagcgagcgctgtcactgccgcttccactggtgctgc
ttcgtggtctgcgaggagtgccgcatcactgagtgggtcagcgtctgcaagtga

KEGG   Camelus dromedarius (Arabian camel): 105097257
Entry
105097257         CDS       T04642                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11 isoform X1
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105097257 (WNT11)
   04390 Hippo signaling pathway
    105097257 (WNT11)
   04150 mTOR signaling pathway
    105097257 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105097257 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105097257 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105097257 (WNT11)
   05205 Proteoglycans in cancer
    105097257 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105097257 (WNT11)
   05226 Gastric cancer
    105097257 (WNT11)
   05217 Basal cell carcinoma
    105097257 (WNT11)
   05224 Breast cancer
    105097257 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105097257 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    105097257 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105097257 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105097257 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105097257 (WNT11)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105097257 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105097257
NCBI-ProteinID: XP_031316238
LinkDB
Position
10
AA seq 461 aa
MRTRPQVCQALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVHAAREAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVATDLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRLPG
LFLPSCPDSAPRTCPQAAEEEAPSHSNLPGLLRMPPASYPPGSATRRHMAVTAVTSCAVD
AATTPTQIAWWSGATASTTGAATSPAAGVSAPWSAMSASEALWDPRRLARVPGDTLWILA
CEFQMLGMEGGLCFASTWKPLGTEAWPPGKEGQDIKGNRQG
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaggacgcggccgcaggtctgccaggcgcttctcttcgccctggcgctccagaccggc
gtgtgctatggcatcaagtggctggcgctgtccaagaccccggcggccctggcgctgaac
cagacacagcactgcaaacagctggagggcctggtgtcggcgcaggtgcagctgtgccgc
agcaacctggagctcatgcacaccatcgtgcacgccgcccgcgaggccatgaaggcctgc
cgcagggccttcgccgacatgcgctggaactgttcctccatcgagctcgcccccaactac
ctgcttgacctggagagagggacccgggagtcagccttcgtgtatgcgctgtcggcggcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgtgcctctctggaaatgaagtgtaagtgccacggggtatctggctcctgctccatc
cgcacctgctggaaggggctgcaggagcttcgggatgtggccactgaccttaagacccgc
tacctgtcggccaccaaggtggtgcaccgacctatgggcacccgcaagcacctagtgccc
aaggacctggacattcggcccgtgaaggactcggagctcgtctatctgcagagctccccc
gacttctgcatgaagaacgagaaggtgggctctcacgggacgcaggacaggttgccaggc
ctcttcctgcccagctgccctgactctgcccctaggacttgtcctcaagctgctgaagag
gaagccccatcccacagcaacctccctggccttctcagaatgccacccgcctcctacccc
ccaggcagtgcaacaagacgtcacatggcagtgacagctgtgacctcatgtgctgtggac
gcggctacaacccctacacagatcgcgtggtggagcggtgccactgcaagtaccactggt
gctgctacgtcacctgccgcaggtgtgagcgcaccgtggagcgctatgtctgcaagtgag
gcgctgtgggaccctcggaggctggccagggtgcctggagacaccctgtggattttggct
tgtgaattccagatgctgggcatggaaggaggcttgtgctttgcctccacttggaagcca
ctgggaacagaggcctggccaccagggaaggagggccaggacatcaaaggaaaccgacaa
ggttaa

KEGG   Camelus dromedarius (Arabian camel): 105102049
Entry
105102049         CDS       T04642                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105102049 (WNT2B)
   04390 Hippo signaling pathway
    105102049 (WNT2B)
   04150 mTOR signaling pathway
    105102049 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105102049 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105102049 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105102049 (WNT2B)
   05205 Proteoglycans in cancer
    105102049 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105102049 (WNT2B)
   05226 Gastric cancer
    105102049 (WNT2B)
   05217 Basal cell carcinoma
    105102049 (WNT2B)
   05224 Breast cancer
    105102049 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105102049 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    105102049 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105102049 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105102049 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105102049 (WNT2B)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105102049 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105102049
NCBI-ProteinID: XP_031313688
LinkDB
Position
9
AA seq 393 aa
MLRPSGAEEAAQLPSRRARAPVPAPAPRPTALDGSRASARLSLACLLLLLLLMLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctgaggccgagtggtgcggaggaagccgcgcagctcccctctcggcgcgcccgcgcc
cctgtccccgcgcccgcgcctagacccacggccctcgacggctctcgggcttcggcccgc
ttgagtcttgcctgccttctgctgctgctgctgctgatgctgccggcccgcgtagacacg
tcctggtggtacattggggcactgggggcccgagtgatctgtgacaatatccctggtctg
gtgagccggcagcggcagctgtgccagcgttacccagacatcatgcgctcagtgggtgag
ggtgcccgagaatggatccgagagtgtcagcaccagttccgccaccaccgctggaactgc
accacactggaccgggaccacactgtcttcggccgagtcatgctcagaagtagccgggag
gcagcatttgtatatgccatctcttcagcaggagtggtccatgctatcactcgggcctgt
agccagggtgaactgagtgtgtgcagctgtgacccctatacccgtggccgacaccatgac
caacgtggggactttgactggggtggttgcagtgacaacattcactatggtgttcgcttt
gccaaggccttcgtggatgccaaggagaagaggcttaaggatgcccgggctctcatgaac
ttacataacaaccgctgtggtcgcacggctgtgcggcggtttctgaagctggaatgtaag
tgccacggcgtgagtggctcctgtactctgcgcacctgctggcgtgctctctcagacttc
cgccgcacaggtgattacctgcggcggcgctatgacggggccgtgcaggtgacggccacc
caggatggtgccaacttcacagcagcccgccaaggctatcgccgtgccacccggactgac
cttgtctactttgacaactccccagactactgtgttttggacaaggctgcaggttcccta
ggcactgcaggccgtgtctgcagcaagacatctaaagggacagacggttgtgaaatcatg
tgctgcggccgagggtatgacacaactcgagttacccgcgtcacccagtgtgagtgcaaa
ttccactggtgctgtgctgtgcgctgcaaggaatgcagaaacactgtggacgtccatact
tgcaaggcccccaagaaggcagagtggctggatcagacctga

KEGG   Camelus dromedarius (Arabian camel): 105102929
Entry
105102929         CDS       T04642                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04360  Axon guidance
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105102929 (WNT5B)
   04390 Hippo signaling pathway
    105102929 (WNT5B)
   04150 mTOR signaling pathway
    105102929 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105102929 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105102929 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    105102929 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105102929 (WNT5B)
   05205 Proteoglycans in cancer
    105102929 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105102929 (WNT5B)
   05226 Gastric cancer
    105102929 (WNT5B)
   05217 Basal cell carcinoma
    105102929 (WNT5B)
   05224 Breast cancer
    105102929 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105102929 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    105102929 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105102929 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105102929 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105102929 (WNT5B)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105102929 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105102929
NCBI-ProteinID: XP_031300250
LinkDB
Position
34
AA seq 361 aa
MPSLLALLTAALLASWAPLPAEAGSWWSLAMNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIGSREDTAFTYA
VRSGPGWVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDA
REREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEF
RKVGDQLKEKYDSAAAVRVTRRGKLELVNSRFNPPTPEDLVYVDPSPDYCLRNDTTGSLG
TQGRLCNKTSEGMDGCALMCCGRGYDQFKSVRVERCHCRFHWCCFVRCRKCAQTVDQFVC
K
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcccagcctgctggccctgctcaccgctgccctgctcgccagctgggctccgcttcca
gccgaagctggctcctggtggtccttggccatgaacccggtgcagagacctgagatgttc
atcatcggtgcccagccggtgtgcagccagctgccggggctctcccctggccagaggaag
ctgtgccagctgtaccaggagcacatggcctacatcggggagggggccaagacgggcatc
cgagagtgccagcaccagttccggcagcggcggtggaactgcagcaccgtggacaacacc
tccgtcttcgggagggtcatgcagatagggagcagggaggacaccgccttcacctacgcc
gtgagaagcgggccggggtgggtcaatgccatcagccgggcctgccgcgagggcgagctg
tccacgtgcggctgcagccggacggcgcggcccaaggacctgccccgggactggctgtgg
gggggctgcggggacaacgtggagtacggctaccgcttcgccaaggagttcgtggacgcc
cgcgagagggagaagaacttcgccaaggggtcggaggagcagggccgcgtgctcatgaac
ctgcagaacaacgaggcgggccgaagggctgtgtataagatggcagacgtagcctgcaag
tgccacggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttc
cgcaaggtgggggaccagctgaaggagaaatacgacagcgcggcggccgtgcgcgtcacc
cggcggggcaagctggagctggtcaacagccgcttcaacccgcccacgcccgaggacctg
gtctacgtggaccccagccccgactactgcctgcgcaacgacaccaccggctcgctgggc
acgcagggccggctgtgcaacaagacgtcggagggcatggacggctgcgcgctcatgtgc
tgcggccgcggctacgaccagttcaagagcgtgcgggtggagcgctgccactgcaggttc
cactggtgctgcttcgtcaggtgcaggaagtgcgcgcagaccgtggaccagttcgtctgc
aagtag

KEGG   Camelus dromedarius (Arabian camel): 105103785
Entry
105103785         CDS       T04642                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105103785 (WNT1)
   04390 Hippo signaling pathway
    105103785 (WNT1)
   04150 mTOR signaling pathway
    105103785 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105103785 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105103785 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105103785 (WNT1)
   05205 Proteoglycans in cancer
    105103785 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105103785 (WNT1)
   05226 Gastric cancer
    105103785 (WNT1)
   05217 Basal cell carcinoma
    105103785 (WNT1)
   05224 Breast cancer
    105103785 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105103785 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    105103785 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105103785 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105103785 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105103785 (WNT1)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105103785 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105103785
NCBI-ProteinID: XP_031318519
LinkDB
Position
12
AA seq 340 aa
MRLTRGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAV
RECKWQFRNRRWNCPTASGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIES
CTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTV
FSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAE
LLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCC
GRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcgtctcaccaggggcatcgtgaacgtagcctcctccacgaacctgctgaccgactct
aagagcctgcaactggtactcgagcccagcctgcagctgctgagccgcaaacagcggcgg
ctgatccgccagaaccctgggatcctccacagtgtgagcggggggctgcagagcgctgtg
cgagagtgcaagtggcagttccggaaccgccgctggaactgtcccacggcttcagggccc
cacctcttcggcaaaatcgtcaaccgaggctgtcgggaaactgcatttatcttcgccatc
acctcagccggggtcacccattcggtggcgcgctcctgctcggagggctccatcgagtcc
tgcacgtgcgactaccggcggcgcggcccggggggtcccgattggcactgggggggctgc
agcgacaacattgacttcggccgcctctttggcagggagtttgtggactccggggagaag
gggcgggacctgcgcttcctcatgaaccttcacaacaacgaggcgggccgcacgacggtg
ttctctgagatgcgccaggagtgtaagtgccacggcatgtccggctcgtgcacggtgcgc
acgtgctggatgcggctgcccacgctgcgcgccgtgggggacgtgctgcgcgaccgcttc
gatggcgcctcgcgcgtcctctacggtaaccgcggcagcaaccgcgcctcgcgggctgaa
ctgctgcgcctcgagccggaagacccagcgcacaagccgccctcccctcacgacctcgtc
tactttgagaaatcgcccaacttctgcacatacagcggacgcttgggtacagcgggcacg
gcggggcgcgcctgcaacagctcgtcgcccgcgctggacggctgcgagctgctctgctgt
ggccggggccaccgcacgcgcacgcagcgcgtcacggagcgctgcaactgcaccttccac
tggtgctgccacgtcagctgccgcaactgcacgcacacgcgcgtcctgcacgagtgcctg
tga

KEGG   Camelus dromedarius (Arabian camel): 105103814
Entry
105103814         CDS       T04642                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105103814 (WNT10B)
   04390 Hippo signaling pathway
    105103814 (WNT10B)
   04150 mTOR signaling pathway
    105103814 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105103814 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105103814 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105103814 (WNT10B)
   05205 Proteoglycans in cancer
    105103814 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105103814 (WNT10B)
   05226 Gastric cancer
    105103814 (WNT10B)
   05217 Basal cell carcinoma
    105103814 (WNT10B)
   05224 Breast cancer
    105103814 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105103814 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    105103814 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105103814 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105103814 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105103814 (WNT10B)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105103814 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 105103814
NCBI-ProteinID: XP_031318518
LinkDB
Position
12
AA seq 389 aa
MREEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSGSSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLQQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgggaggagccccggccgcggcctccgccctcgggcctcgcgggtctcctgttcctg
gcgttgtgcagtcgggccctaagcaatgagattctgggcctgaagctgccgggcgagccg
ccgctgaccgccaacaccgtgtgcttgacgctgtcgggcctgagcaagcggcagttaggc
ctgtgcctgcgcagccccgacgtgacggcgtcggcgcttcagggcctgcacatcgcagtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctctgcgctggagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgggagagtgctttttcc
ttctccatgctggctgctggggtcatgcacgcagtagccacggcctgcagcctgggcaag
ctggtgagctgcggctgcggctggaagggcagtggtgagcaggatcggctgagggccaaa
ctgctgcagctgcaggcactgtcccggggcaagagttttccccactccttgcccagccca
ggccctggctcaggctccagtcctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgcatgcgaatccacaacaacagggtggggcgccaggtggtaact
gaaaacctgaagcggaaatgcaagtgccatggcacgtctggcagctgccagttcaagacc
tgctggagggcagccccagagttccgagcggtgggggcagccttgagggagcggctgggc
cgtgccatcttcatcgatacccacaaccgcaactctggagcattccaaccccgccttcgt
ccccgacgcctctcaggagagctggtctactttgagaagtctcctgacttctgtgagcga
gaccccaccgtgggctccccgggcacgcggggccgggcctgcaacaagaccagtcgcctg
ctggatggctgtggcagcctgtgctgtggccgtgggcacaatgtgctccagcagacgagg
gttgaacgctgtcactgccgcttccactggtgctgctatgtgctgtgtgacgagtgcaag
gtcacagagtgggtcaacgtgtgtaagtga

DBGET integrated database retrieval system