KEGG   Camelus dromedarius (Arabian camel): 105084606
Entry
105084606         CDS       T04642                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00120  Primary bile acid biosynthesis
cdk01100  Metabolic pathways
cdk03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    105084606
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105084606
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105084606
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     105084606
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     105084606
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP8 family
   105084606
SSDB
Motif
Pfam: p450 ThiS
Other DBs
NCBI-GeneID: 105084606
NCBI-ProteinID: XP_010973047
LinkDB
Position
17
AA seq 501 aa
MVLWGPVLGALLVAIVGCMWLLGMLRQRRPKEPPLDKGSVPWLGHAMAFRKNMFEFLKHM
RAKHGEIFTVQLGGQYFTFVVDPLSFGPILKDAQRKLDFVEYAQKLVLKVFGYRSVQGDY
RMIHSASTKHLMGDGLEELNRAMLDSLSLAMLGPTGPSPDASCWHEDGLFRFCYNILFKA
GYLSLFGYTKDKKQELLQAEELFVEFRKFDRLFPRFVYSLLGPREWLEVGRLQRLFHKAL
SVEHNLEKCGISNWITYMLQFLREQGVVPAMQDKFNFMMLWASQGNTGPTSFWALLFLLK
HPEAMRAVREEATQVLGEARLEAGKSFDFNISALHQMPVLDSVMEETLRLGAAPTLLRVV
NNDHILKMSNGQDYLLRSGDILALFPYLSVHMDPDIHPEPTTFKYDRFLTPSGSRKVDFY
KAGKKIHHYTMPWGSGVSICPGRFLALSEMKLFVLLMVTHFDLELVDPDTTVPPVDPQRW
GFGTTQPSHEVRFRYRLRPAE
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggtgctctgggggccagtgctgggagccctgctggtggccattgtcgggtgcatgtgg
ctgctggggatgctccggcaacgaagacccaaggaaccccctctggataagggctccgtt
ccctggctgggccatgccatggctttccggaagaatatgtttgaatttctgaagcacatg
cgggccaagcacggggagatattcacagtacagctagggggtcagtacttcacctttgtc
gtggaccccctctcctttggccccatcctcaaggatgcacagagaaaactagattttgtg
gaatatgcacaaaaattggtgctaaaggtatttggctaccgctccgtgcagggagactac
cggatgattcactcagccagcaccaagcacctcatgggggatggcttggaggagctcaac
agagccatgctggacagcctgtccttggctatgctggggcccaccggcccaagtccggat
gccagctgctggcatgaggatggcctctttcgcttctgctacaatatcctgttcaaggcc
ggctacctgagcttgttcggctacacaaaggacaagaagcaggaactgctccaggcggag
gagttatttgtggagtttcgtaaattcgatcgcctgttccccaggtttgtctactccctg
ctggggccccgggagtggctagaagtgggccggctccagcgtctcttccacaaggcactc
tctgtggaacacaacctggagaaatgtggcataagcaattggataacctacatgctgcag
tttctgagggagcagggagtagtcccagccatgcaggacaagttcaacttcatgatgctc
tgggcctcccagggtaacacggggcctacctctttctgggccctcctgttcctcctgaag
cacccagaggccatgcgggctgtaagagaggaggccacccaggtcctgggggaggccagg
ctggaggctgggaagtccttcgacttcaacatcagcgccctgcaccaaatgccagtgttg
gacagtgtgatggaagagacactgcggctgggggctgcgcccaccctcctcagggtggtg
aacaatgaccacatcctgaagatgtccaatgggcaggactacctgctccgcagtggagat
atcctggccctcttcccttatctctcagtgcacatggatcctgacatccaccctgagcca
actaccttcaagtacgatcgctttctcactcccagtggcagccgaaaagtagacttctac
aaggcaggcaagaagatccaccactacaccatgccatggggctcgggcgtctctatctgc
cctggcaggttcttggccctcagcgagatgaagctgtttgtcctgctcatggtcacacac
tttgacctggagctggtggaccctgacacaactgtcccacctgtggacccccagcgctgg
ggctttggcactacacagcccagccacgaggtgcgcttccgctaccgcctgcggcctgct
gagtga

DBGET integrated database retrieval system