KEGG   Camelus dromedarius (Arabian camel): 105084622Help
Entry
105084622         CDS       T04642                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04015  Rap1 signaling pathway
cdk04310  Wnt signaling pathway
cdk04390  Hippo signaling pathway
cdk04510  Focal adhesion
cdk04520  Adherens junction
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04670  Leukocyte transendothelial migration
cdk04916  Melanogenesis
cdk04919  Thyroid hormone signaling pathway
cdk04934  Cushing syndrome
cdk05100  Bacterial invasion of epithelial cells
cdk05160  Hepatitis C
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    105084622 (CTNNB1)
   04310 Wnt signaling pathway
    105084622 (CTNNB1)
   04390 Hippo signaling pathway
    105084622 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105084622 (CTNNB1)
   04520 Adherens junction
    105084622 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    105084622 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    105084622 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    105084622 (CTNNB1)
   04916 Melanogenesis
    105084622 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105084622 (CTNNB1)
   05205 Proteoglycans in cancer
    105084622 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105084622 (CTNNB1)
   05225 Hepatocellular carcinoma
    105084622 (CTNNB1)
   05226 Gastric cancer
    105084622 (CTNNB1)
   05216 Thyroid cancer
    105084622 (CTNNB1)
   05217 Basal cell carcinoma
    105084622 (CTNNB1)
   05215 Prostate cancer
    105084622 (CTNNB1)
   05213 Endometrial cancer
    105084622 (CTNNB1)
   05224 Breast cancer
    105084622 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105084622 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    105084622 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105084622 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    105084622 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    105084622 (CTNNB1)
   05163 Human cytomegalovirus infection
    105084622 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105084622 (CTNNB1)
   05165 Human papillomavirus infection
    105084622 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 105084622
NCBI-ProteinID: XP_010973082
LinkDB All DBs
Position
Un
AA seq 770 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHRDPALVKMLGSPVDSV
LFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQES
KLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT
DPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNN
YKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGL
PVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRT
SMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQ
RVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYK
KRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGM
DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcagcagtcttacctggactctggaatccattctggtgccact
accacagctccttctctaagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggagcagggattttcccagtccttcactcaagaacaagtagct
gatattgacggacagtatgcaatgactcgagctcagagggtacgggcggctatgttccct
gagacgttagatgagggcatgcagatcccatctacgcagtttgatgccgctcatcccact
aacgtccagcgtctggctgagccatcacagatgctgaagcatgcagttgtaaatctgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgcta
aatgatgaagaccaggtggtggtgaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacatgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcaaaacacaaatgatgtggaaacggctcgctgtacggctgggaccttgcacaat
ctctcccaccaccgtgatcctgccctggtgaagatgcttggttcaccagtggattctgta
ttgttttatgccattacaactctccacaaccttttgctgcatcaggaaggagctaaaatg
gcagtgcgtttagctggcgggctgcagaaaatggttgccttgctcaacaaaacaaatgtt
aaattcttggctattacaacagactgccttcagattttagcttacggcaatcaagaaagc
aagctgatcattctggctagtggtggacctcaagctttagtgaatataatgaggacctac
acttacgagaaactcctgtggaccacaagcagggtactgaaggtgctgtctgtctgctct
agtaacaagccggctattgtagaggctggtggaatgcaggctttaggacttcacctgacg
gatccaagtcagcgtcttgttcagaactgtctttggactcttaggaatctttcagatgct
gcaactaaacaggaagggatggaaggtcttcttgggacccttgttcagcttctgggctca
gatgatataaacgtggtcacctgtgcagctggaattctttctaatctcacttgcaataat
tataagaacaagatgatggtgtgccaagtgggtggtatagaggctcttgtgcgtactgtc
cttcgtgctggtgacagggaggacatcactgagcctgccatctgtgctcttcgtcatctg
accagccgacaccaggaagctgagatggcccagaatgctgttcgccttcactacggacta
ccagtcgtggtgaaactcctccacccgccatcccactggcctctgatcaaggctaccgtt
ggattgattcgcaatcttgccctttgcccagcaaatcacgcacctttgcgtgagcagggt
gccattccacgactagtccagttgctagtgcgtgcacatcaggatacccagcgtcgtaca
tctatgggtggaacacagcagcagtttgtggagggggtccgcatggaagaaatagtggaa
ggttgtactggagcccttcacatcctagctcgggatgttcacaaccgaattgttatcaga
ggactaaataccattccactgtttgtgcagctgctgtattcgcccattgagaatatccaa
agagtagctgcaggggtcctgtgtgagctcgctcaggacaaggaggctgcagaagccatc
gaggccgagggagccaccgcaccgctgacggagctacttcactcccggaacgagggcgtg
gcaacgtacgcagctgctgttttgttccggatgtcagaggacaagccacaggattataag
aaacggctttcggttgaattgaccagttctctcttcagaacggagcccatggcttggaac
gagactgctgatcttggacttgatattggtgcccagggagaaccccttggatatcgccag
gatgatcccagctatcgttcttttcactccggtggatacggacaggatgccttgggtatg
gaccccatgatggagcacgagatgggaggccaccaccctggtgctgactatccagttgat
gggctgccggatctggggcatgcccaggacctcatggacgggctgcctccgggtgacagc
aatcagctggcctggtttgatactgacctgtaa

DBGET integrated database retrieval system