KEGG   Camelus dromedarius (Arabian camel): 105084758
Entry
105084758         CDS       T04642                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04380  Osteoclast differentiation
cdk04510  Focal adhesion
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04611  Platelet activation
cdk04613  Neutrophil extracellular trap formation
cdk04620  Toll-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04668  TNF signaling pathway
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04926  Relaxin signaling pathway
cdk04929  GnRH secretion
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04973  Carbohydrate digestion and absorption
cdk05010  Alzheimer disease
cdk05017  Spinocerebellar ataxia
cdk05020  Prion disease
cdk05100  Bacterial invasion of epithelial cells
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05146  Amoebiasis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105084758 (PIK3R1)
   04014 Ras signaling pathway
    105084758 (PIK3R1)
   04015 Rap1 signaling pathway
    105084758 (PIK3R1)
   04370 VEGF signaling pathway
    105084758 (PIK3R1)
   04630 JAK-STAT signaling pathway
    105084758 (PIK3R1)
   04668 TNF signaling pathway
    105084758 (PIK3R1)
   04066 HIF-1 signaling pathway
    105084758 (PIK3R1)
   04068 FoxO signaling pathway
    105084758 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    105084758 (PIK3R1)
   04072 Phospholipase D signaling pathway
    105084758 (PIK3R1)
   04071 Sphingolipid signaling pathway
    105084758 (PIK3R1)
   04024 cAMP signaling pathway
    105084758 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    105084758 (PIK3R1)
   04152 AMPK signaling pathway
    105084758 (PIK3R1)
   04150 mTOR signaling pathway
    105084758 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105084758 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    105084758 (PIK3R1)
   04218 Cellular senescence
    105084758 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105084758 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    105084758 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105084758 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105084758 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    105084758 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    105084758 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    105084758 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    105084758 (PIK3R1)
   04660 T cell receptor signaling pathway
    105084758 (PIK3R1)
   04662 B cell receptor signaling pathway
    105084758 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    105084758 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    105084758 (PIK3R1)
   04670 Leukocyte transendothelial migration
    105084758 (PIK3R1)
   04062 Chemokine signaling pathway
    105084758 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105084758 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    105084758 (PIK3R1)
   04929 GnRH secretion
    105084758 (PIK3R1)
   04915 Estrogen signaling pathway
    105084758 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    105084758 (PIK3R1)
   04917 Prolactin signaling pathway
    105084758 (PIK3R1)
   04926 Relaxin signaling pathway
    105084758 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    105084758 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    105084758 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105084758 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105084758 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    105084758 (PIK3R1)
   04722 Neurotrophin signaling pathway
    105084758 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105084758 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    105084758 (PIK3R1)
   04380 Osteoclast differentiation
    105084758 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    105084758 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    105084758 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105084758 (PIK3R1)
   05206 MicroRNAs in cancer
    105084758 (PIK3R1)
   05205 Proteoglycans in cancer
    105084758 (PIK3R1)
   05203 Viral carcinogenesis
    105084758 (PIK3R1)
   05230 Central carbon metabolism in cancer
    105084758 (PIK3R1)
   05231 Choline metabolism in cancer
    105084758 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105084758 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105084758 (PIK3R1)
   05212 Pancreatic cancer
    105084758 (PIK3R1)
   05225 Hepatocellular carcinoma
    105084758 (PIK3R1)
   05226 Gastric cancer
    105084758 (PIK3R1)
   05214 Glioma
    105084758 (PIK3R1)
   05221 Acute myeloid leukemia
    105084758 (PIK3R1)
   05220 Chronic myeloid leukemia
    105084758 (PIK3R1)
   05218 Melanoma
    105084758 (PIK3R1)
   05211 Renal cell carcinoma
    105084758 (PIK3R1)
   05215 Prostate cancer
    105084758 (PIK3R1)
   05213 Endometrial cancer
    105084758 (PIK3R1)
   05224 Breast cancer
    105084758 (PIK3R1)
   05222 Small cell lung cancer
    105084758 (PIK3R1)
   05223 Non-small cell lung cancer
    105084758 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105084758 (PIK3R1)
   05017 Spinocerebellar ataxia
    105084758 (PIK3R1)
   05020 Prion disease
    105084758 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105084758 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105084758 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    105084758 (PIK3R1)
   04931 Insulin resistance
    105084758 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105084758 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    105084758 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    105084758 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105084758 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    105084758 (PIK3R1)
   05161 Hepatitis B
    105084758 (PIK3R1)
   05160 Hepatitis C
    105084758 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    105084758 (PIK3R1)
   05164 Influenza A
    105084758 (PIK3R1)
   05162 Measles
    105084758 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    105084758 (PIK3R1)
   05163 Human cytomegalovirus infection
    105084758 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105084758 (PIK3R1)
   05169 Epstein-Barr virus infection
    105084758 (PIK3R1)
   05165 Human papillomavirus infection
    105084758 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105084758 (PIK3R1)
   05142 Chagas disease
    105084758 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105084758 (PIK3R1)
   01524 Platinum drug resistance
    105084758 (PIK3R1)
   01522 Endocrine resistance
    105084758 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105084758 (PIK3R1)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105084758 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 DUF4201 SH3_2 Laminin_I Lant_dehydr_C PI_PP_I FANCI_S2 Mod_r Exonuc_VII_L
Other DBs
NCBI-GeneID: 105084758
NCBI-ProteinID: XP_031302075
LinkDB
Position
3
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPSSSKTEADSEQHASTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLECDAASVDLDMIDVH
VLADTFKRYLLDLPNPVIPVAVYSEMISLAQEVQSSEEYIQLLKKLIRAPNIPHQYWLTL
QYLLKHFFKLSQSSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKVIEILIATEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgagggataccagtaccgagcgctgtatgactataaaaaggagcgggaagag
gacattgacctgcacttgggtgacatattgactgtcaataaaggatccttagtcgctctc
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggttataat
gaaaccacaggggagagaggcgactttccaggaacttacgttgaatatattggaaggaaa
agaatctcacctcccacaccaaagccccggccgcctcgaccccttcctgtcgcaccaagt
tcttcaaaaactgaagcagacagcgagcaacacgcttcgacgctcccagaccttgcagag
cagtttgcccctcctgatgtcgctccaccgctcctcatcaagctggtggaagccattgaa
aagaaaggtctggaatgttcaactctctacagaacacagagctccagcaacctagcagaa
ctacgacagcttcttgaatgtgatgccgcctccgtggacttggacatgatcgatgtgcat
gttttagcagacactttcaaacgctatctcctggacttaccaaatcctgtcattccggta
gccgtttacagtgagatgatttctttagcccaagaagtgcaaagctccgaagaatacatc
cagctgttgaaaaagctcattcgggcgcctaacatacctcatcagtattggctcacgctt
cagtatttgctgaaacatttcttcaagctctctcaaagctccagcaaaaaccttctgaat
gcaagagttctctctgaacttttcagccctctgcttttcagattcccagcagccagctct
gagaatactgaacacctcataaaagttatagaaattttaatcgcgaccgaatggaatgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggcgatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagccgacgggacctttttggtacgagatgca
tctactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaattct
gtggttgaactaataaaccactaccggaatgaatctctagctcagtataatcccaaactg
gatgtgaaattactgtatccagtgtccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcaatttcaagaaaagagt
cgggaatatgatagattatatgaagattatacccgtacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaactataaaaatatttgaagaacagtgccaaact
caggagcggtacagcaaagaatacatagagaagtttaaacgtgaaggcaatgagaaagaa
atacaaaggattatgcataattatgaaaaattaaagtctcgaatcagtgaaattgtcgac
agcaggcgaaggctggaggaggacttgaagaagcaggcggccgagtaccgcgagattgac
aagcgcatgaacagcattaaacccgaccttattcagctgagaaagaccagagaccaatac
ttgatgtggttgactcagaaaggtgttcggcagaagaagctgaatgagtggctgggcaat
gagaacactgaagaccaatattcgctggtggaagatgacgaggacttgccccaccacgat
gagaagacctggaacgtgggaagcagcaaccgaaacaaagccgaaaacctactgcggggg
aaacgagacggaacttttctggtccgggaaagcagtaaacagggctgctacgcctgctct
gtggtggtggacggcgaggtcaagcactgcgtcatcaacaagacggccacgggctacggc
ttcgcggagccctacaacctgtacggctccctcaaggagctggtgctccactaccagcac
acgtccctcgtgcagcacaacgactccctcaacgtcacactggcctacccggtgtacgcg
caacagcggcgatga

KEGG   Camelus dromedarius (Arabian camel): 105085928
Entry
105085928         CDS       T04642                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00562  Inositol phosphate metabolism
cdk01100  Metabolic pathways
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04380  Osteoclast differentiation
cdk04510  Focal adhesion
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04611  Platelet activation
cdk04613  Neutrophil extracellular trap formation
cdk04620  Toll-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04668  TNF signaling pathway
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04926  Relaxin signaling pathway
cdk04929  GnRH secretion
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04973  Carbohydrate digestion and absorption
cdk05010  Alzheimer disease
cdk05017  Spinocerebellar ataxia
cdk05020  Prion disease
cdk05100  Bacterial invasion of epithelial cells
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05146  Amoebiasis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105085928 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105085928 (PIK3CA)
   04014 Ras signaling pathway
    105085928 (PIK3CA)
   04015 Rap1 signaling pathway
    105085928 (PIK3CA)
   04370 VEGF signaling pathway
    105085928 (PIK3CA)
   04630 JAK-STAT signaling pathway
    105085928 (PIK3CA)
   04668 TNF signaling pathway
    105085928 (PIK3CA)
   04066 HIF-1 signaling pathway
    105085928 (PIK3CA)
   04068 FoxO signaling pathway
    105085928 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    105085928 (PIK3CA)
   04072 Phospholipase D signaling pathway
    105085928 (PIK3CA)
   04071 Sphingolipid signaling pathway
    105085928 (PIK3CA)
   04024 cAMP signaling pathway
    105085928 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    105085928 (PIK3CA)
   04152 AMPK signaling pathway
    105085928 (PIK3CA)
   04150 mTOR signaling pathway
    105085928 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105085928 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    105085928 (PIK3CA)
   04218 Cellular senescence
    105085928 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105085928 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    105085928 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105085928 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105085928 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    105085928 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    105085928 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    105085928 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    105085928 (PIK3CA)
   04660 T cell receptor signaling pathway
    105085928 (PIK3CA)
   04662 B cell receptor signaling pathway
    105085928 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    105085928 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    105085928 (PIK3CA)
   04670 Leukocyte transendothelial migration
    105085928 (PIK3CA)
   04062 Chemokine signaling pathway
    105085928 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105085928 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    105085928 (PIK3CA)
   04929 GnRH secretion
    105085928 (PIK3CA)
   04915 Estrogen signaling pathway
    105085928 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    105085928 (PIK3CA)
   04917 Prolactin signaling pathway
    105085928 (PIK3CA)
   04926 Relaxin signaling pathway
    105085928 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    105085928 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    105085928 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105085928 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105085928 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    105085928 (PIK3CA)
   04722 Neurotrophin signaling pathway
    105085928 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105085928 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    105085928 (PIK3CA)
   04380 Osteoclast differentiation
    105085928 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    105085928 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    105085928 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085928 (PIK3CA)
   05206 MicroRNAs in cancer
    105085928 (PIK3CA)
   05205 Proteoglycans in cancer
    105085928 (PIK3CA)
   05203 Viral carcinogenesis
    105085928 (PIK3CA)
   05230 Central carbon metabolism in cancer
    105085928 (PIK3CA)
   05231 Choline metabolism in cancer
    105085928 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105085928 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105085928 (PIK3CA)
   05212 Pancreatic cancer
    105085928 (PIK3CA)
   05225 Hepatocellular carcinoma
    105085928 (PIK3CA)
   05226 Gastric cancer
    105085928 (PIK3CA)
   05214 Glioma
    105085928 (PIK3CA)
   05221 Acute myeloid leukemia
    105085928 (PIK3CA)
   05220 Chronic myeloid leukemia
    105085928 (PIK3CA)
   05218 Melanoma
    105085928 (PIK3CA)
   05211 Renal cell carcinoma
    105085928 (PIK3CA)
   05215 Prostate cancer
    105085928 (PIK3CA)
   05213 Endometrial cancer
    105085928 (PIK3CA)
   05224 Breast cancer
    105085928 (PIK3CA)
   05222 Small cell lung cancer
    105085928 (PIK3CA)
   05223 Non-small cell lung cancer
    105085928 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105085928 (PIK3CA)
   05017 Spinocerebellar ataxia
    105085928 (PIK3CA)
   05020 Prion disease
    105085928 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105085928 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105085928 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    105085928 (PIK3CA)
   04931 Insulin resistance
    105085928 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105085928 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105085928 (PIK3CA)
   05135 Yersinia infection
    105085928 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    105085928 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105085928 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    105085928 (PIK3CA)
   05161 Hepatitis B
    105085928 (PIK3CA)
   05160 Hepatitis C
    105085928 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    105085928 (PIK3CA)
   05164 Influenza A
    105085928 (PIK3CA)
   05162 Measles
    105085928 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    105085928 (PIK3CA)
   05163 Human cytomegalovirus infection
    105085928 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105085928 (PIK3CA)
   05169 Epstein-Barr virus infection
    105085928 (PIK3CA)
   05165 Human papillomavirus infection
    105085928 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105085928 (PIK3CA)
   05142 Chagas disease
    105085928 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105085928 (PIK3CA)
   01524 Platinum drug resistance
    105085928 (PIK3CA)
   01522 Endocrine resistance
    105085928 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105085928 (PIK3CA)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105085928 (PIK3CA)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105085928 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 105085928
NCBI-ProteinID: XP_031307328
LinkDB
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacatttttgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtatgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaacgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtcatagtttctcca
aataatgacaaacaaaagtatactctgaaaatcaaccacgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaataccagggcaagtatatattaaaagtgtgtggatgtgacgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatctgatgctgatggctaaagaaagcctctactctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gagacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggggaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccagatggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactcttgtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccttgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aacgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaggagaaggattttctgtggagccacaggcactattgtgtaact
attcctgaaattctacccaaattgcttctgtctgtcaaatggaattctagagatgaagta
gctcagatgtattgcttggtaaaagactggcctccaatcaaacctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaagttttgctgttagatgtttggaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcattgactaat
caaaggatcgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtggaatgtatttgaag
cacctgaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaaaaaggatgaaacgcaaaaggtacagatgaaatttttagttgagcaaatgcgg
cgaccagatttcatggatgctctacagggctttctgtcccctctaaaccctgctcatcaa
ctgggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactctgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgttaacacttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcaaatt
cagtgcaaaggcggcctgaaaggtgcactgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaagggagaaatatatgatgcagccattgatctttttacacgttcg
tgtgctggatattgtgttgctactttcattttggggattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaattgtttcatatagattttggacactttctggatcac
aagaagaaaaaatttggttataaacgagagcgtgtaccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaggaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tatattcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgctttgaactga

KEGG   Camelus dromedarius (Arabian camel): 105086305
Entry
105086305         CDS       T04642                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00562  Inositol phosphate metabolism
cdk01100  Metabolic pathways
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04380  Osteoclast differentiation
cdk04510  Focal adhesion
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04611  Platelet activation
cdk04613  Neutrophil extracellular trap formation
cdk04620  Toll-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04668  TNF signaling pathway
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04926  Relaxin signaling pathway
cdk04929  GnRH secretion
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04973  Carbohydrate digestion and absorption
cdk05010  Alzheimer disease
cdk05017  Spinocerebellar ataxia
cdk05020  Prion disease
cdk05100  Bacterial invasion of epithelial cells
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05146  Amoebiasis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105086305 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105086305 (PIK3CB)
   04014 Ras signaling pathway
    105086305 (PIK3CB)
   04015 Rap1 signaling pathway
    105086305 (PIK3CB)
   04370 VEGF signaling pathway
    105086305 (PIK3CB)
   04630 JAK-STAT signaling pathway
    105086305 (PIK3CB)
   04668 TNF signaling pathway
    105086305 (PIK3CB)
   04066 HIF-1 signaling pathway
    105086305 (PIK3CB)
   04068 FoxO signaling pathway
    105086305 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    105086305 (PIK3CB)
   04072 Phospholipase D signaling pathway
    105086305 (PIK3CB)
   04071 Sphingolipid signaling pathway
    105086305 (PIK3CB)
   04024 cAMP signaling pathway
    105086305 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    105086305 (PIK3CB)
   04152 AMPK signaling pathway
    105086305 (PIK3CB)
   04150 mTOR signaling pathway
    105086305 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105086305 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    105086305 (PIK3CB)
   04218 Cellular senescence
    105086305 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105086305 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    105086305 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105086305 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105086305 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    105086305 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    105086305 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    105086305 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    105086305 (PIK3CB)
   04660 T cell receptor signaling pathway
    105086305 (PIK3CB)
   04662 B cell receptor signaling pathway
    105086305 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    105086305 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    105086305 (PIK3CB)
   04670 Leukocyte transendothelial migration
    105086305 (PIK3CB)
   04062 Chemokine signaling pathway
    105086305 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105086305 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    105086305 (PIK3CB)
   04929 GnRH secretion
    105086305 (PIK3CB)
   04915 Estrogen signaling pathway
    105086305 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    105086305 (PIK3CB)
   04917 Prolactin signaling pathway
    105086305 (PIK3CB)
   04926 Relaxin signaling pathway
    105086305 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    105086305 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    105086305 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105086305 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105086305 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    105086305 (PIK3CB)
   04722 Neurotrophin signaling pathway
    105086305 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105086305 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    105086305 (PIK3CB)
   04380 Osteoclast differentiation
    105086305 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    105086305 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    105086305 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105086305 (PIK3CB)
   05206 MicroRNAs in cancer
    105086305 (PIK3CB)
   05205 Proteoglycans in cancer
    105086305 (PIK3CB)
   05203 Viral carcinogenesis
    105086305 (PIK3CB)
   05230 Central carbon metabolism in cancer
    105086305 (PIK3CB)
   05231 Choline metabolism in cancer
    105086305 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105086305 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105086305 (PIK3CB)
   05212 Pancreatic cancer
    105086305 (PIK3CB)
   05225 Hepatocellular carcinoma
    105086305 (PIK3CB)
   05226 Gastric cancer
    105086305 (PIK3CB)
   05214 Glioma
    105086305 (PIK3CB)
   05221 Acute myeloid leukemia
    105086305 (PIK3CB)
   05220 Chronic myeloid leukemia
    105086305 (PIK3CB)
   05218 Melanoma
    105086305 (PIK3CB)
   05211 Renal cell carcinoma
    105086305 (PIK3CB)
   05215 Prostate cancer
    105086305 (PIK3CB)
   05213 Endometrial cancer
    105086305 (PIK3CB)
   05224 Breast cancer
    105086305 (PIK3CB)
   05222 Small cell lung cancer
    105086305 (PIK3CB)
   05223 Non-small cell lung cancer
    105086305 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105086305 (PIK3CB)
   05017 Spinocerebellar ataxia
    105086305 (PIK3CB)
   05020 Prion disease
    105086305 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105086305 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105086305 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    105086305 (PIK3CB)
   04931 Insulin resistance
    105086305 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105086305 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105086305 (PIK3CB)
   05135 Yersinia infection
    105086305 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    105086305 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105086305 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    105086305 (PIK3CB)
   05161 Hepatitis B
    105086305 (PIK3CB)
   05160 Hepatitis C
    105086305 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    105086305 (PIK3CB)
   05164 Influenza A
    105086305 (PIK3CB)
   05162 Measles
    105086305 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    105086305 (PIK3CB)
   05163 Human cytomegalovirus infection
    105086305 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105086305 (PIK3CB)
   05169 Epstein-Barr virus infection
    105086305 (PIK3CB)
   05165 Human papillomavirus infection
    105086305 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105086305 (PIK3CB)
   05142 Chagas disease
    105086305 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105086305 (PIK3CB)
   01524 Platinum drug resistance
    105086305 (PIK3CB)
   01522 Endocrine resistance
    105086305 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105086305 (PIK3CB)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105086305 (PIK3CB)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105086305 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 105086305
NCBI-ProteinID: XP_031299174
LinkDB
Position
1
AA seq 1070 aa
MCFHSIMPPAMADILDIWAVDSQIGSDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRSTIHGKEDE
VSPHDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFHIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASNDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVMLSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttccactccataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagataggatctgatggctccatacctgtggacttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcctatattaaacagatgttatgg
aaacaagttcacaattacccaatgtttaacctccttatggaaattgattcctatatgttt
gcatgtgtgaatcagactgctgtgtacgaggagctcgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggcagaggtctgcatgaatttgatgccttg
aaggatcctgaagttaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctaaagcagacctatccaccagagcat
gaaccatccatccctgagaatttagaagataagctttatggaggaaagcttattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtatctcctaacatgaatcct
atcaaaataaatgaattggcaatccaaaaacgttcgactattcatgggaaagaagatgaa
gttagcccccatgactatgtgttgcaagtcagtgggagagtagagtatgtgtttggtgat
caccccctaattcagttccagtatatccgtaactgtgtgatgaacaggaccttgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtacgaacaggaaatgattgccatc
gaggccgccataaatcgaaattcgtctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaaccctttccacattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggccggcctttttcatggt
actgaactcctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatatcaatacttgtgacctgccacggatggctcgatta
tgttttgctgtttatgcagttttggataaagtcaaaacgaagaaatcaactaaaactatt
aatccctctaaatatcagaccatcaggaaatctggaaaagtgcattatcctgtagcgtgg
gtaaatacaatggtttttgactttaaaggacagttgagatctggagatataatactgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcag
acaaatccatatactgaaaatgcaacagctttgcacatcaaatttccagagaataaaaag
caaccttattactaccctccttttgataagattattgaaaaggcagctgagattgcaagc
aatgatagtgctaatgtgtcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatccattgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacagtcattgccaaaattactgctgtcaatc
aagtggaataagcttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccctggagcttctcgatttcaactatccagatcagtacgtgcga
gaatatgcagtgggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctccagattccta
ttagaaagagcacttgctaatcggaggatagggcagtttctattttggcaccttaggtca
gaagtgcacattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgtcgg
ggaagtgtaggtcacatgaaagcactttccaagcaggttgaagcactcaataaattaaaa
actttaaatagtctaatcaaactgaatgcagtgaagctaaatagagccaaagggaaggag
gccatgcacacttgtttaaaacagaatgcttaccgggaagccctttctgacctgcagtca
cctctgaacccgtgtgtcatgctctcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcccttgtggctggtgtacaacaacaaggtgtttggagaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaagatatgttgactctccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggatcttcggatgttgccttacggc
tgtttagcaacaggagaccgctccggcctcattgaagttgtgagcacctctgaaacaatc
gctgacattcagctaaacagtagcaatgtggctgctgcagcagccttcaacaaagacgcc
cttctgaactggcttaaagagtacaattctggggatgacctggaccgagccattgaggag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acctatgacttcattcatgtgattcagcaaggaaaaacaggaaacacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Camelus dromedarius (Arabian camel): 105092913
Entry
105092913         CDS       T04642                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04380  Osteoclast differentiation
cdk04510  Focal adhesion
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04611  Platelet activation
cdk04613  Neutrophil extracellular trap formation
cdk04620  Toll-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04668  TNF signaling pathway
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04926  Relaxin signaling pathway
cdk04929  GnRH secretion
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04973  Carbohydrate digestion and absorption
cdk05010  Alzheimer disease
cdk05017  Spinocerebellar ataxia
cdk05020  Prion disease
cdk05100  Bacterial invasion of epithelial cells
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05146  Amoebiasis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105092913
   04014 Ras signaling pathway
    105092913
   04015 Rap1 signaling pathway
    105092913
   04370 VEGF signaling pathway
    105092913
   04630 JAK-STAT signaling pathway
    105092913
   04668 TNF signaling pathway
    105092913
   04066 HIF-1 signaling pathway
    105092913
   04068 FoxO signaling pathway
    105092913
   04070 Phosphatidylinositol signaling system
    105092913
   04072 Phospholipase D signaling pathway
    105092913
   04071 Sphingolipid signaling pathway
    105092913
   04024 cAMP signaling pathway
    105092913
   04151 PI3K-Akt signaling pathway
    105092913
   04152 AMPK signaling pathway
    105092913
   04150 mTOR signaling pathway
    105092913
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105092913
  09143 Cell growth and death
   04210 Apoptosis
    105092913
   04218 Cellular senescence
    105092913
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105092913
   04550 Signaling pathways regulating pluripotency of stem cells
    105092913
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105092913
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105092913
   04613 Neutrophil extracellular trap formation
    105092913
   04620 Toll-like receptor signaling pathway
    105092913
   04625 C-type lectin receptor signaling pathway
    105092913
   04650 Natural killer cell mediated cytotoxicity
    105092913
   04660 T cell receptor signaling pathway
    105092913
   04662 B cell receptor signaling pathway
    105092913
   04664 Fc epsilon RI signaling pathway
    105092913
   04666 Fc gamma R-mediated phagocytosis
    105092913
   04670 Leukocyte transendothelial migration
    105092913
   04062 Chemokine signaling pathway
    105092913
  09152 Endocrine system
   04910 Insulin signaling pathway
    105092913
   04923 Regulation of lipolysis in adipocytes
    105092913
   04929 GnRH secretion
    105092913
   04915 Estrogen signaling pathway
    105092913
   04914 Progesterone-mediated oocyte maturation
    105092913
   04917 Prolactin signaling pathway
    105092913
   04926 Relaxin signaling pathway
    105092913
   04935 Growth hormone synthesis, secretion and action
    105092913
   04919 Thyroid hormone signaling pathway
    105092913
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105092913
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105092913
  09156 Nervous system
   04725 Cholinergic synapse
    105092913
   04722 Neurotrophin signaling pathway
    105092913
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105092913
  09158 Development and regeneration
   04360 Axon guidance
    105092913
   04380 Osteoclast differentiation
    105092913
  09149 Aging
   04211 Longevity regulating pathway
    105092913
   04213 Longevity regulating pathway - multiple species
    105092913
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105092913
   05206 MicroRNAs in cancer
    105092913
   05205 Proteoglycans in cancer
    105092913
   05203 Viral carcinogenesis
    105092913
   05230 Central carbon metabolism in cancer
    105092913
   05231 Choline metabolism in cancer
    105092913
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105092913
  09162 Cancer: specific types
   05210 Colorectal cancer
    105092913
   05212 Pancreatic cancer
    105092913
   05225 Hepatocellular carcinoma
    105092913
   05226 Gastric cancer
    105092913
   05214 Glioma
    105092913
   05221 Acute myeloid leukemia
    105092913
   05220 Chronic myeloid leukemia
    105092913
   05218 Melanoma
    105092913
   05211 Renal cell carcinoma
    105092913
   05215 Prostate cancer
    105092913
   05213 Endometrial cancer
    105092913
   05224 Breast cancer
    105092913
   05222 Small cell lung cancer
    105092913
   05223 Non-small cell lung cancer
    105092913
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105092913
   05017 Spinocerebellar ataxia
    105092913
   05020 Prion disease
    105092913
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105092913
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105092913
   04932 Non-alcoholic fatty liver disease
    105092913
   04931 Insulin resistance
    105092913
   04933 AGE-RAGE signaling pathway in diabetic complications
    105092913
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    105092913
   05100 Bacterial invasion of epithelial cells
    105092913
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105092913
   05170 Human immunodeficiency virus 1 infection
    105092913
   05161 Hepatitis B
    105092913
   05160 Hepatitis C
    105092913
   05171 Coronavirus disease - COVID-19
    105092913
   05164 Influenza A
    105092913
   05162 Measles
    105092913
   05168 Herpes simplex virus 1 infection
    105092913
   05163 Human cytomegalovirus infection
    105092913
   05167 Kaposi sarcoma-associated herpesvirus infection
    105092913
   05169 Epstein-Barr virus infection
    105092913
   05165 Human papillomavirus infection
    105092913
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105092913
   05142 Chagas disease
    105092913
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105092913
   01524 Platinum drug resistance
    105092913
   01522 Endocrine resistance
    105092913
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105092913
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105092913
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 105092913
NCBI-ProteinID: XP_010982984
LinkDB
Position
13
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKESSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYGSLKELVLHYQHTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggcgggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagctgttacaaatggaatgaaggagagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgt
gacatgccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattat
actttgactttgaggaagggaggcaataataagctaataaagatctatcatcgagatggt
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
caccatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccagataccaacaggatcaattggtaaaagaagataacattgatgcagtaggtaaaaaa
ctgcaagaataccactctcagtatcaggaaaagagtaaagaatatgacaggctatatgaa
gaatacaccagaacatcccaggaaatccagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagaatat
attgagcgatttcggagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatccgagatcagcacctcgtgtggctcaatcacaaagga
gtgaggcagaagcgtctaaatgcctggctgggaatcaagaatgaagatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccactatgatgagaaaacctggtttgtt
gaggatatcaaccgagtacaagcagaggacttgctttacgggaaacctgatggtgcattc
ttaattcgagagagtagcaagaaaggatgttacgcttgctctgtggtcgccgacggggaa
gtgaagcactgtgtgatctacagcactgctcggggctacggcttcgcggagccctacaac
ctgtacggctctctgaaggagctggtgctgcactaccagcacacgtccctggtccagcac
aacgactccctcaacgtcaggctggcctaccccgtccacgcacagatgccctcgctctgc
agataa

KEGG   Camelus dromedarius (Arabian camel): 105101867
Entry
105101867         CDS       T04642                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04380  Osteoclast differentiation
cdk04510  Focal adhesion
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04611  Platelet activation
cdk04613  Neutrophil extracellular trap formation
cdk04620  Toll-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04668  TNF signaling pathway
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04926  Relaxin signaling pathway
cdk04929  GnRH secretion
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04973  Carbohydrate digestion and absorption
cdk05010  Alzheimer disease
cdk05017  Spinocerebellar ataxia
cdk05020  Prion disease
cdk05100  Bacterial invasion of epithelial cells
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05146  Amoebiasis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105101867 (PIK3R2)
   04014 Ras signaling pathway
    105101867 (PIK3R2)
   04015 Rap1 signaling pathway
    105101867 (PIK3R2)
   04370 VEGF signaling pathway
    105101867 (PIK3R2)
   04630 JAK-STAT signaling pathway
    105101867 (PIK3R2)
   04668 TNF signaling pathway
    105101867 (PIK3R2)
   04066 HIF-1 signaling pathway
    105101867 (PIK3R2)
   04068 FoxO signaling pathway
    105101867 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    105101867 (PIK3R2)
   04072 Phospholipase D signaling pathway
    105101867 (PIK3R2)
   04071 Sphingolipid signaling pathway
    105101867 (PIK3R2)
   04024 cAMP signaling pathway
    105101867 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    105101867 (PIK3R2)
   04152 AMPK signaling pathway
    105101867 (PIK3R2)
   04150 mTOR signaling pathway
    105101867 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105101867 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    105101867 (PIK3R2)
   04218 Cellular senescence
    105101867 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105101867 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    105101867 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105101867 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105101867 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    105101867 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    105101867 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    105101867 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    105101867 (PIK3R2)
   04660 T cell receptor signaling pathway
    105101867 (PIK3R2)
   04662 B cell receptor signaling pathway
    105101867 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    105101867 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    105101867 (PIK3R2)
   04670 Leukocyte transendothelial migration
    105101867 (PIK3R2)
   04062 Chemokine signaling pathway
    105101867 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105101867 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    105101867 (PIK3R2)
   04929 GnRH secretion
    105101867 (PIK3R2)
   04915 Estrogen signaling pathway
    105101867 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    105101867 (PIK3R2)
   04917 Prolactin signaling pathway
    105101867 (PIK3R2)
   04926 Relaxin signaling pathway
    105101867 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    105101867 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    105101867 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105101867 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105101867 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    105101867 (PIK3R2)
   04722 Neurotrophin signaling pathway
    105101867 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105101867 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    105101867 (PIK3R2)
   04380 Osteoclast differentiation
    105101867 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    105101867 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    105101867 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105101867 (PIK3R2)
   05206 MicroRNAs in cancer
    105101867 (PIK3R2)
   05205 Proteoglycans in cancer
    105101867 (PIK3R2)
   05203 Viral carcinogenesis
    105101867 (PIK3R2)
   05230 Central carbon metabolism in cancer
    105101867 (PIK3R2)
   05231 Choline metabolism in cancer
    105101867 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105101867 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105101867 (PIK3R2)
   05212 Pancreatic cancer
    105101867 (PIK3R2)
   05225 Hepatocellular carcinoma
    105101867 (PIK3R2)
   05226 Gastric cancer
    105101867 (PIK3R2)
   05214 Glioma
    105101867 (PIK3R2)
   05221 Acute myeloid leukemia
    105101867 (PIK3R2)
   05220 Chronic myeloid leukemia
    105101867 (PIK3R2)
   05218 Melanoma
    105101867 (PIK3R2)
   05211 Renal cell carcinoma
    105101867 (PIK3R2)
   05215 Prostate cancer
    105101867 (PIK3R2)
   05213 Endometrial cancer
    105101867 (PIK3R2)
   05224 Breast cancer
    105101867 (PIK3R2)
   05222 Small cell lung cancer
    105101867 (PIK3R2)
   05223 Non-small cell lung cancer
    105101867 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105101867 (PIK3R2)
   05017 Spinocerebellar ataxia
    105101867 (PIK3R2)
   05020 Prion disease
    105101867 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105101867 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105101867 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    105101867 (PIK3R2)
   04931 Insulin resistance
    105101867 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105101867 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    105101867 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    105101867 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105101867 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    105101867 (PIK3R2)
   05161 Hepatitis B
    105101867 (PIK3R2)
   05160 Hepatitis C
    105101867 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    105101867 (PIK3R2)
   05164 Influenza A
    105101867 (PIK3R2)
   05162 Measles
    105101867 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    105101867 (PIK3R2)
   05163 Human cytomegalovirus infection
    105101867 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105101867 (PIK3R2)
   05169 Epstein-Barr virus infection
    105101867 (PIK3R2)
   05165 Human papillomavirus infection
    105101867 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105101867 (PIK3R2)
   05142 Chagas disease
    105101867 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105101867 (PIK3R2)
   01524 Platinum drug resistance
    105101867 (PIK3R2)
   01522 Endocrine resistance
    105101867 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105101867 (PIK3R2)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105101867 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e ATG11 Tai4
Other DBs
NCBI-GeneID: 105101867
NCBI-ProteinID: XP_031293488
LinkDB
Position
22
AA seq 723 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGSERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIDRTGLDSYRPEPPAARTDWSLSDMEQWDAATLSDGVKGFLLALPS
PLVTPEAAAEAHRALREAAGPVGPVLEPPTLPLHHALTLRFLLQHLGRVARRAAAPGPVV
RALGATFGPLLLRAPPPSPPPGGAPDGTEPIPDFPALLVEKLLQEHLEEQEVAPPALPPK
PPKAKPASTGLANGGNPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEY
TLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYPV
SKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFN
ETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQE
LRVQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQY
SLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDT
KHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPP
AAR
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggctggggctgagggcttccaataccgtgctctgtacccattccgccgggaacggcca
gaggacctggagctgctgccaggtgatgtccttgtggtgagccgggcggccctacaggca
ctgggcgtggctgagggcagcgagcgttgcccacagagtgtgggctggatgcctggcctc
aacgagcgtacacggcagcgcggcgacttccctggcacctacgttgagttcctggggcct
gtggccctggcccggcctggccctcgcccacgtggcccccgcccgctgcccgccaggccc
cgagatgggccccctgagccaggcctcacactccctgacctacccgagcagttctcccca
cctgatgtggcgccccctatcctggtgaagcttgtggaggccattgatcggacagggcta
gacagctacagacctgagccacctgccgcacgcacagactggtccctaagtgacatggag
cagtgggacgcggcaaccctgtcagatggcgtgaagggcttcctgctagcgctgccctct
ccccttgtgacacctgaggccgcggccgaagcacatcgagccctgcgggaggccgcaggg
cccgtggggccagtgctggagcccccgacgctgccactgcaccacgcgctcacgctgcgc
ttcctgctccagcatctgggccgggtggcccggcgcgccgcagcgccgggccccgtggtg
cgtgccctgggcgccaccttcgggccgctgctgctgcgtgcgccaccgccctcgccgcca
ccagggggcgcgcccgacgggactgagcccatccccgacttccctgctctgctggtggag
aagttgcttcaggaacatctggaggagcaggaggttgcgcccccagcactgccgcctaaa
ccccccaaggcaaagccggcctccacaggcctggccaatggggggaacccgccctccctg
caggatgctgaatggtactggggtgacatctccagggaggaggtaaacgagaaactccgg
gacacacctgatggtacctttctggtccgagatgcatccagcaagatccagggggagtac
acgctgacccttaggaaaggcgggaacaacaagctgatcaaggtcttccaccgagacggt
cactacggcttctcagagccgctcaccttctgctctgtcgtggacctcatcacccactac
cgccatgagtcactggcccagtacaatgccaagctggacactcggctcctctacccagtg
tccaagtaccagcaggaccagattgtcaaggaggacagcgtggaagcagtgggcgcccag
cttaaagtctatcaccagcagtaccaagacaagagccgcgagtacgaccagctctatgag
gagtacacacgcacctcccaggaactgcagatgaagcgcacagccatcgaggccttcaat
gagaccatcaagatctttgaagagcagggccagacgcaagagaagtgcagcaaggagtat
ctggagcgcttccggcgtgagggcaatgagaaggagatgcagaggatcctgctgaactcc
gagcggctcaagtctcgcattgctgagatccacgagagccgcacaaagctggagcaggag
ctacgggtgcaggcctctgacaaccgagagatcgacaagcgcatgaacagcctcaagcca
gacctcatgcagctgcgcaagatccgagaccagtaccttgtgtggctcactcagaaaggt
gcccggcagaagaaaatcaacgaatggttgggaatcaaaaacgagactgaggaccagtac
tcactgatggaagatgaggatgaccttccccaccatgaggaacgcacgtggtatgtaggc
aagatcaaccgcacacaagctgaggaaatgctgagtggcaagcgggatggcaccttcctc
atccgtgagagcagccagcgcggctgctacgcctgctccgtggtggtggatggtgacacc
aaacactgcgttatctaccgcacagccacgggcttcggctttgcagagccctataacttg
tacgggtcgctgaaggagctggtgctgcactaccagcatgcctcactggtgcagcacaac
gacgcgctcaccgtcacgctcgcccatcccgtgcgcgccccaggccccgggcccccacct
gccgcccgctga

KEGG   Camelus dromedarius (Arabian camel): 105107003
Entry
105107003         CDS       T04642                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00562  Inositol phosphate metabolism
cdk01100  Metabolic pathways
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04380  Osteoclast differentiation
cdk04510  Focal adhesion
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04611  Platelet activation
cdk04613  Neutrophil extracellular trap formation
cdk04620  Toll-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04668  TNF signaling pathway
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04926  Relaxin signaling pathway
cdk04929  GnRH secretion
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04973  Carbohydrate digestion and absorption
cdk05010  Alzheimer disease
cdk05017  Spinocerebellar ataxia
cdk05020  Prion disease
cdk05100  Bacterial invasion of epithelial cells
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05146  Amoebiasis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105107003 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105107003 (PIK3CD)
   04014 Ras signaling pathway
    105107003 (PIK3CD)
   04015 Rap1 signaling pathway
    105107003 (PIK3CD)
   04370 VEGF signaling pathway
    105107003 (PIK3CD)
   04630 JAK-STAT signaling pathway
    105107003 (PIK3CD)
   04668 TNF signaling pathway
    105107003 (PIK3CD)
   04066 HIF-1 signaling pathway
    105107003 (PIK3CD)
   04068 FoxO signaling pathway
    105107003 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    105107003 (PIK3CD)
   04072 Phospholipase D signaling pathway
    105107003 (PIK3CD)
   04071 Sphingolipid signaling pathway
    105107003 (PIK3CD)
   04024 cAMP signaling pathway
    105107003 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    105107003 (PIK3CD)
   04152 AMPK signaling pathway
    105107003 (PIK3CD)
   04150 mTOR signaling pathway
    105107003 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105107003 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    105107003 (PIK3CD)
   04218 Cellular senescence
    105107003 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105107003 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    105107003 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105107003 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105107003 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    105107003 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    105107003 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    105107003 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    105107003 (PIK3CD)
   04660 T cell receptor signaling pathway
    105107003 (PIK3CD)
   04662 B cell receptor signaling pathway
    105107003 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    105107003 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    105107003 (PIK3CD)
   04670 Leukocyte transendothelial migration
    105107003 (PIK3CD)
   04062 Chemokine signaling pathway
    105107003 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105107003 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    105107003 (PIK3CD)
   04929 GnRH secretion
    105107003 (PIK3CD)
   04915 Estrogen signaling pathway
    105107003 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    105107003 (PIK3CD)
   04917 Prolactin signaling pathway
    105107003 (PIK3CD)
   04926 Relaxin signaling pathway
    105107003 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    105107003 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    105107003 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105107003 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105107003 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    105107003 (PIK3CD)
   04722 Neurotrophin signaling pathway
    105107003 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105107003 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    105107003 (PIK3CD)
   04380 Osteoclast differentiation
    105107003 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    105107003 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    105107003 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105107003 (PIK3CD)
   05206 MicroRNAs in cancer
    105107003 (PIK3CD)
   05205 Proteoglycans in cancer
    105107003 (PIK3CD)
   05203 Viral carcinogenesis
    105107003 (PIK3CD)
   05230 Central carbon metabolism in cancer
    105107003 (PIK3CD)
   05231 Choline metabolism in cancer
    105107003 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105107003 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105107003 (PIK3CD)
   05212 Pancreatic cancer
    105107003 (PIK3CD)
   05225 Hepatocellular carcinoma
    105107003 (PIK3CD)
   05226 Gastric cancer
    105107003 (PIK3CD)
   05214 Glioma
    105107003 (PIK3CD)
   05221 Acute myeloid leukemia
    105107003 (PIK3CD)
   05220 Chronic myeloid leukemia
    105107003 (PIK3CD)
   05218 Melanoma
    105107003 (PIK3CD)
   05211 Renal cell carcinoma
    105107003 (PIK3CD)
   05215 Prostate cancer
    105107003 (PIK3CD)
   05213 Endometrial cancer
    105107003 (PIK3CD)
   05224 Breast cancer
    105107003 (PIK3CD)
   05222 Small cell lung cancer
    105107003 (PIK3CD)
   05223 Non-small cell lung cancer
    105107003 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105107003 (PIK3CD)
   05017 Spinocerebellar ataxia
    105107003 (PIK3CD)
   05020 Prion disease
    105107003 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105107003 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105107003 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    105107003 (PIK3CD)
   04931 Insulin resistance
    105107003 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105107003 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105107003 (PIK3CD)
   05135 Yersinia infection
    105107003 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    105107003 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105107003 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    105107003 (PIK3CD)
   05161 Hepatitis B
    105107003 (PIK3CD)
   05160 Hepatitis C
    105107003 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    105107003 (PIK3CD)
   05164 Influenza A
    105107003 (PIK3CD)
   05162 Measles
    105107003 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    105107003 (PIK3CD)
   05163 Human cytomegalovirus infection
    105107003 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105107003 (PIK3CD)
   05169 Epstein-Barr virus infection
    105107003 (PIK3CD)
   05165 Human papillomavirus infection
    105107003 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105107003 (PIK3CD)
   05142 Chagas disease
    105107003 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105107003 (PIK3CD)
   01524 Platinum drug resistance
    105107003 (PIK3CD)
   01522 Endocrine resistance
    105107003 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105107003 (PIK3CD)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105107003 (PIK3CD)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105107003 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 105107003
NCBI-ProteinID: XP_031319872
LinkDB
Position
13
AA seq 1044 aa
MPPGVDCPMEFWTKEENQDVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLQDPEVNDFRAKMRQFCEEAAVRRQQLSWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LRVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPASQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECRLYMWPSVPDEKGELLNPSGTVRSNPNTESAAALVIFLPEVAP
HPVYYPALDKILELGRHGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTPKPQTKELMHMCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
VRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYSILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaagaggagaatcaggacgtg
gcagttgacttcttgctgcccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggttttgtggcaccgagcccagtatgagccgctcttccac
atgctcagtgaccccgaggcctatgtgttcacctgcgtcaaccagaccgcagagcagcag
gagctggaggacgagcagcggcggctgtgtgacatccagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggggacagagtgaagaagctcatcaactcccagatcagcctgctc
attggcaaaggcctccacgagtttgactccttgcaagacccggaagtgaatgactttcga
gccaagatgcgccagttctgcgaggaggcagctgtgcggagacagcagctgagctgggag
gcctggctgcagtacagcttcccgctgcagctggagccttcagcacggagctgggggcca
ggcaccctgcgcgtccccaaccgggccctcctggtcaacgtcaagttcgagggtagtgag
gagagcttcaccttccaggtgtccaccaaggatgtgcccctggcactgatggcctgcgcc
ctccggaagaaggccacagtgttccggcagccgctggtggagcagcctgaggactacacg
ctgcgagtgaacgggaggcatgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggctgaccccgcacctgaccatggtgcattcctcc
tccatcctcgccatgcgggacgaacagagcaaccccgcctcccaagtccaaaaaccgcgc
accaagccgccccccattcccatgaagaagccttcctcagtgtctctgtggtccctggag
cagcctttctgcatcgagctgatccagggcagcaaagtgaatgcagatgagcggatgaag
ctggtggtgcaggccgggctcttccatggcaacgagacactgtgcaagacggtgtccagc
tcagaggtgagcgtgtgctcagaacccgtatggaagcagcggctggagttcgacatcaat
gtgtgcgacctgccgcgcatggcccgcctctgctttgcactttatgccgtgattgagaag
gccaagaaggcgcgctctaccaagaagaagtccaagaaggcggactgccccatcgcgtgg
gccaacctcatgttgtttgactacaaggaccagctcaagaccggcgagtgccgcctctac
atgtggccctccgtcccagatgagaaaggggagctgctgaacccctcgggaactgtgcgg
agtaatcccaacactgagagtgcagccgctctggtcatctttctccctgaggtggccccc
caccctgtgtactaccctgccctggacaagatcctggagctggggcggcacggggagcat
gggcgcttcacggaggaggagcagctgcagctgcgggaaatcctggagcggcggggatcc
ggggagctgtatgagcacgagaaggacctggtgtggaagatgcggcacgagatccaggag
cacttccccgaggcgctggcccggctgctgctggtcaccaagtggaacaaacatgaggac
gtggcccagatgctctacctgctgtgctcctggcctgagctgcctgtcctgagtgccctg
gagctgctggacttcagcttccccgaccgccacgtgggctccttcgccatcaagtccctg
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaagttcctgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtctgtg
gccctgcgcttcggcctcatcatggaggcctactgccggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagctctgagcaaactgaaggccctgaacgactttgtcaaa
gtgagctcccagaagacgcccaagccgcagaccaaggagctgatgcacatgtgcatgcgc
caggagacctacctggaggccctctcccacctgcagtccccgctcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
gtcatgtacagcaacgaggaggccggcagtgacggcagcgtgggcatcatcttcaagaac
ggggatgacctccgccaggacatgctgaccctgcagatgatccagctcatggacattctg
tggaagcaggaggggttggacctgaggatgaccccctatggctgcctctccaccggggac
cgcacaggcctcatcgaggtcgttcttcactcggacaccatcgccaacatccagctgaac
aagagcaacatggcggccacagctgccttcaacaaagatgctctactcaactggctcaag
tccaagaaccctggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgcgtggccacgtacgtgctgggcatcggtgatcggcacagcgacaacatcatg
gtccgggagaacggccagcttttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtcccattcatcctcacctatgactttgtccac
gtgatccagcaggggaagacgaataatagtgagaaatttgaaaggttccggggctactgt
gagagggcctactccatcctgcggcggcacgggctgctcttcctccacctcttcgccctc
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggat
tctctggccttgggaaaaacagaggaggaggctctgaagcacttccgagtgaagtttaac
gaagccctccgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacagacaatag

DBGET integrated database retrieval system