KEGG   Camelus dromedarius (Arabian camel): 105085024
Entry
105085024         CDS       T04642                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00562  Inositol phosphate metabolism
cdk01100  Metabolic pathways
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04072  Phospholipase D signaling pathway
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04613  Neutrophil extracellular trap formation
cdk04650  Natural killer cell mediated cytotoxicity
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04919  Thyroid hormone signaling pathway
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk05012  Parkinson disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05135  Yersinia infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05223  Non-small cell lung cancer
cdk05225  Hepatocellular carcinoma
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
cdk_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105085024 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105085024 (PLCG1)
   04014 Ras signaling pathway
    105085024 (PLCG1)
   04015 Rap1 signaling pathway
    105085024 (PLCG1)
   04370 VEGF signaling pathway
    105085024 (PLCG1)
   04064 NF-kappa B signaling pathway
    105085024 (PLCG1)
   04066 HIF-1 signaling pathway
    105085024 (PLCG1)
   04020 Calcium signaling pathway
    105085024 (PLCG1)
   04070 Phosphatidylinositol signaling system
    105085024 (PLCG1)
   04072 Phospholipase D signaling pathway
    105085024 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    105085024 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    105085024 (PLCG1)
   04660 T cell receptor signaling pathway
    105085024 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    105085024 (PLCG1)
   04659 Th17 cell differentiation
    105085024 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    105085024 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    105085024 (PLCG1)
   04670 Leukocyte transendothelial migration
    105085024 (PLCG1)
   04062 Chemokine signaling pathway
    105085024 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    105085024 (PLCG1)
   04919 Thyroid hormone signaling pathway
    105085024 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105085024 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105085024 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    105085024 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085024 (PLCG1)
   05206 MicroRNAs in cancer
    105085024 (PLCG1)
   05205 Proteoglycans in cancer
    105085024 (PLCG1)
   05231 Choline metabolism in cancer
    105085024 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105085024 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105085024 (PLCG1)
   05214 Glioma
    105085024 (PLCG1)
   05223 Non-small cell lung cancer
    105085024 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    105085024 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    105085024 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105085024 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    105085024 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105085024 (PLCG1)
   05171 Coronavirus disease - COVID-19
    105085024 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105085024 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105085024 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105085024 (PLCG1)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     105085024 (PLCG1)
Membrane trafficking [BR:cdk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    105085024 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    105085024 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 105085024
NCBI-ProteinID: XP_031289659
LinkDB
Position
19
AA seq 1383 aa
MAGAASPCANGCGPGAPSDAEVLNLCRNLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
IWSRGADKFEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNHEDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRTSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLEEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
GTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLVSYYERHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIGTVDAAAGQLTSTVLMG
WSLRVTATWRQEGRGTWPQVAVTCHWAAASSAVKQAWQSSGTSSRGTGWGDGDTFVPQLC
SPLPLAIRPEGKNNRLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLT
EGKMMERRKKIALELSELVVYCRPVPFDEDKIGTERACYRDMSSFPETKAEKYVNKAKGK
KFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGG
HCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAG
AEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATF
LVKGLKTGYRAVPLKNNYSEDLELASLLVKIDVFPAKQENGDLSPFGGASLRERGCDASG
QLFHGRAREGSFEARYQQPFEDFRISQEHLSDHFDSRERSIILATPLFFPEEAPEWTEPC
GRQ
NT seq 4152 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaatggctgcgggcccggcgcgccctcggacgct
gaggtgctgaacctctgccgcaacctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggcccgagcggaagaccttccaggtcaagctggagacgcggcagatc
atatggagccgtggcgccgacaagttcgagggggccatcgatattcgtgaaatcaaggag
atccgcccagggaagacctcacgggactttgaccgctaccaagaggatcctgcttttcga
ccagaccagtcacactgctttgtcatcctgtatggaatggaattccgcctgaagactttg
agcttgcaagccacgtctgaggacgaagtgaacatgtggatcaagggcttgacttggctg
atggaggatacattgcaggcggccacacccctgcagattgagaggtggctgcggaagcag
ttctactcagtggaccggaatcatgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcgactgacggac
ctggagcagcgcaccagcgacatcacctatgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcctggaagccagtgccctgagggcg
ggggagcggccggagctctgccgggtgtcccttcctgagttccagcaattcctcctcgag
taccagggggagctgtgggctgttgaccggctccaagtgcaggagttcatgctcagcttc
ctccgagaccccttgcgagagatcgaggagccttacttcttcctggaagagtttgtcacc
ttcctgttctccaaggagaacagtgtgtggaactcgcagctggacgccgtgtgcccagac
accatgaacaatcctctctcccactactggatctcctcctcacacaacacgtacctgact
ggtgaccagttctccagcgagtcctccctggaagcctacgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggatggcccagacgggatgccagtcatttaccat
ggacacaccttgaccaccaagatcaagttctcagacgtcctgcacaccatcaaggagcac
gcctttgtggcctcagagtacccagtcatcctgtccatcgaggaccactgcagcatcgcc
cagcagaggaacatggcccagcacttcaggaaggtgctcggggacacactcctcaccaag
cccgtggacatcgccgccgacgggctcccctcacccaaccagctcaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcctatgaggaggtgcctacgtccgtgatg
tactctgagaacgacatcagcaactccatcaagaacggcattctctacctggaggacccc
gtgaaccacgagtggtatccccactactttgttctgaccagcagcaaaatctactactct
gaggagaccagcagtgaccagggcaatgaggacgaagaggagcccaaggaggccagcggc
ggcacagagctgcactccaacgagaagtggttccatgggaagctcggggcggggcgggac
gggcgacacatcgccgagcgcctgcttacagagtactgcatcgagaccggggcacccgac
ggctccttcctcgtgcgcgagagcgagaccttcgtgggtgactacaccctctccttctgg
cggaacgggaaagtccagcactgccggatccactctcggcaggacgctgggacccccaag
ttcttcctgacagacaacctcgtcttcgactcactctatgacctcatcacgcactaccag
caggttcccctgcgctgcaacgaatttgagatgcgcctctcagagcccgtcccacagacc
aacgcccacgagagcaaagagtggtaccacgccagcctgaccagagcacaggccgagcac
atgctgatgcgcgtaccccgggatggggccttcctggtgcggaaacggaatgagcccaac
tcctacgccatctccttccgggctgaggggaagatcaagcactgccgagtccagcaggag
ggccagactgtgatgctgggcaactcagagtttgacagcctcgttgacctcgtcagctac
tatgagaggcaccccctgtaccgcaagatgaagctgcgctatcccatcaatgaggaggcg
ctggagaagatcggcacggctgagcctgactatggagcgctgtacgaggggcgcaaccct
ggcttctacgtggaggcaaaccccatgccaactttcaagtgtgccgtcaaagctctcttt
gactataaggcccagagagaagatgagctgacttttaccaagagtgccatcatccagaac
gtggagaagcaagagggaggctggtggcggggggactatggtgggaagaagcagctgtgg
ttcccttcaaactacgtggaagagatggtcagcccagcagccctggagcctgagagggag
cacttggatgagaacagccccctgggggacttgctgcggggggtcttggatgtgccagct
tgtcagataggcaccgtggatgctgctgctggccagctgacatccacagtcctgatgggt
tggtccctgcgtgtgacagcgacgtggagacaggaggggaggggcacatggccccaagta
gcagtgacttgtcactgggctgcagcatcctcagctgtaaaacaggcctggcagagcagt
ggcacctcatctcggggcacggggtggggggacggggacacatttgtcccccagctctgc
tctcctctccctctagccatccgtcccgagggcaagaacaaccggctgttcgtcttctcc
atcagtatggcatcagtggcacactggtccctggatgtggctgctgactcacaggaggag
ctgcaggactgggtgaaaaagatccgagaagtagcccagactgcggatgccaggctcaca
gaggggaagatgatggagcggaggaagaagatcgccctggagctctcggagcttgttgtc
tactgccggcctgttcccttcgacgaagacaagatcggcacagaacgcgcttgctaccgg
gacatgtcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaag
aagttcctccagtacaaccggctgcagctgtcccgcatctaccccaagggccagcggctg
gactcctccaactatgaccctttgcccatgtggatctgtggcagtcagctggtggccctc
aacttccagaccccagacaagcccatgcagatgaaccaggccctcttcatggccggcggg
cactgtggctacgtgctgcagcccagcaccatgcgggacgaggccttcgaccccttcgac
aagagcagcctccgggggctggagccgtgtgctatctccatcgaggtgctgggggcccga
catctgccgaagaacggccggggcatcgtgtgtccttttgtggagattgaggtggctgga
gcagaatatgacagcaccaagcagaagacagagtttgtggtggacaacggactgaaccct
gtgtggccagccaagcccttccacttccagatcagtaaccccgaattcgccttcctgcgt
ttcgtggtgtatgaggaagacatgtttagtgaccagaacttcctggctcaggccaccttc
ttggtgaagggcctgaagacgggatacagagcggtgcctttgaagaacaactacagtgag
gacctggagctggcctccctgctcgtcaagatagatgttttccctgccaagcaggagaac
ggcgacctgagtccattcggcggggcatccctgcgggagcgaggctgcgacgcctcgggc
cagctatttcatgggcgggcccgggaaggctcctttgaagcccgctaccagcagccattt
gaggacttccgcatctcccaggagcatctctcggaccattttgacagtcgggaacgaagc
ataattttggcaacaccgctgttctttccagaggaggcaccagagtggaccgagccgtgt
gggagacagtga

KEGG   Camelus dromedarius (Arabian camel): 105089440
Entry
105089440         CDS       T04642                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 isoform X1
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00562  Inositol phosphate metabolism
cdk01100  Metabolic pathways
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04020  Calcium signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04072  Phospholipase D signaling pathway
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04380  Osteoclast differentiation
cdk04611  Platelet activation
cdk04613  Neutrophil extracellular trap formation
cdk04625  C-type lectin receptor signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04919  Thyroid hormone signaling pathway
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05223  Non-small cell lung cancer
cdk05225  Hepatocellular carcinoma
Module
cdk_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105089440 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105089440 (PLCG2)
   04014 Ras signaling pathway
    105089440 (PLCG2)
   04370 VEGF signaling pathway
    105089440 (PLCG2)
   04064 NF-kappa B signaling pathway
    105089440 (PLCG2)
   04066 HIF-1 signaling pathway
    105089440 (PLCG2)
   04020 Calcium signaling pathway
    105089440 (PLCG2)
   04070 Phosphatidylinositol signaling system
    105089440 (PLCG2)
   04072 Phospholipase D signaling pathway
    105089440 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105089440 (PLCG2)
   04613  Neutrophil extracellular trap formation
    105089440 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    105089440 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    105089440 (PLCG2)
   04662 B cell receptor signaling pathway
    105089440 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    105089440 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    105089440 (PLCG2)
   04670 Leukocyte transendothelial migration
    105089440 (PLCG2)
   04062 Chemokine signaling pathway
    105089440 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    105089440 (PLCG2)
   04919 Thyroid hormone signaling pathway
    105089440 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105089440 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105089440 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    105089440 (PLCG2)
   04380 Osteoclast differentiation
    105089440 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105089440 (PLCG2)
   05206 MicroRNAs in cancer
    105089440 (PLCG2)
   05205 Proteoglycans in cancer
    105089440 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105089440 (PLCG2)
   05214 Glioma
    105089440 (PLCG2)
   05223 Non-small cell lung cancer
    105089440 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105089440 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105089440 (PLCG2)
   05171 Coronavirus disease - COVID-19
    105089440 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105089440 (PLCG2)
   05169 Epstein-Barr virus infection
    105089440 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105089440 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105089440 (PLCG2)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     105089440 (PLCG2)
Membrane trafficking [BR:cdk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    105089440 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    105089440 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 GDPD EF-hand_like
Other DBs
NCBI-GeneID: 105089440
NCBI-ProteinID: XP_031313858
LinkDB
Position
9
AA seq 1265 aa
MSTMANVDSLPEYEKSQIKRALELGTVMTVFSSRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFSIFYGTQFILSTLSLAADSKEDAT
KWLSGLKILHQEVMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKAILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDDKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQNVEDELPPDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCAEMGGKDGTFLVRESETYPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYY
LTDNLMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDVNSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADVEELEKQII
EDNPLGSLCRGILDLNTYNVVKASQGRNQKSFVFTLDPKKQGDPPVEFATDSVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADCVVRQKPNDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGAQMVALNFQTADKY
MQLNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKPGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAATQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNHQLFLYDTHQNLRNATRDALVREFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgagcaccatggccaatgtggacagcctcccagaatatgagaagagtcagatcaagaga
gccctggagctgggcacagtcatgaccgtgttcagctcccgcaagtctaccccggagcgg
aggaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagactgctgacaag
atcgagggtttcttggacattatggagataaaggaaatccgcccggggaagaactccaaa
gatttcgagcgtgcgaaggcagtccgccagaaggaagactgctgcttttccatcttttac
ggcacccagttcatcctcagcacactcagcttagcagctgactctaaggaagatgcaact
aagtggctttctggcttgaagatcttacaccaggaagtgatgagcgcgtccacacccacc
atcattgagagttggctgagaaaacagatttattctgtggatcaaaccaggagaaacagc
atcagcctccgagagttgaaggccatcttacccctggtcaacttcaaagtgagcagcgct
aagttcctcaaagataaatttgtggaaataggcgcgcacaaggatgaactcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaatcgattctggacgaa
ttcaaaaaggattcctccgtgttcatcttgggcaacacggaccggccagatgcctctgct
gttcacctgcacgacttccagcggtttctcttacatgaacagcaggagctttgggctcag
gatctgaacaaagtccgtgagcggatgacgaagtttatcgacgacacaatgagagaaact
gctgagcccttcttgtttgtggatgagttcctcacgtacctgttttcacgggagaacagc
atttgggatgacaagtatgacgtggtggacatgcaggacatgaacaaccccttgtctcat
tactggatctcctcgtcacataacacgtaccttacgggtgaccagctgcggagcgagtca
tccaccgaggcgtacatccgctgcctgcggatgggctgccgctgcatcgagctggactgc
tgggatgggccggacgggaaacctatcatctaccacggctggacgcggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacctcgagcttcccg
gtgatcctgtccatcgaggagcactgctgtgtggagcagcagcgccacatggccagggtg
ttcaaggaggtgtttggcgacctgctgctgaccaagcccacggaggccagtgccgaccag
ctgccctcgcccagccagctgcgagagaagatcatcatcaagcataagaagctgggtccc
cgtggcgacgtggatgtcaacatggaggacaagaaggatgagcacaagcagcagggtgaa
ctgtacatgtgggattccatcgaccagaaatggactcggcactactgtgccattgctgat
gccaagctgtccttcagcgatgacattgaacagaatgtggaggacgaactgcccccggac
ataccccccacagagctgcattttggggagaagtggttccacaagaaggtggagaagagg
acgagtgcggagaagctgctgcaggaatattgcgccgagatggggggcaaggatgggacc
ttcttggtgcgggagagcgagacctaccccaatgactacaccctgtccttctggcggtcg
ggccgcgtccagcattgccggatccgctccactatggagggcgggaccatgaagtactac
ctgactgacaacctcatgttcaccagcatctacgccctcatccagcactaccgggaaaca
cacctgcgctgtgccgagttcgagctccggctgactgaccccgtgcccaaccccaacccc
cacgagtctaagccgtggtactacgatggactgagtcgtggagaagcagaggacatgctg
atgagggttccccgggacggggccttcctgatccggaagcgggaaggtactgactcctat
gccatcaccttcagagccaggggcaaggtgaagcactgccgcatcaaccgggacggccgg
cacttcgtgctgggcacctccgcctacttcgagagcctcgtggagctggtcagctactac
gagaagcatgcgctgtaccggaagatgaggctgcgctaccccgtgacccccgagctcctg
gagcggtataacatggaaagagatgtcaactccctctatgacgtcagcagaatgtatgtg
gaccccagtgaaatcaatccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaaacgcagcgatgagctgagcttctgccgtggcgccctcattcacaacgtctcc
aaggagcccgggggctggtggaaaggagactacggaaccagaatccagcagtacttcccg
tccaattacgtcgaggacatttcgacagctgacgtggaggagctggaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatactggatctcaacacctataatgtt
gtaaaagcctcacaggggagaaaccagaagtcttttgtgttcaccttggaccccaagaag
cagggtgatcctccagtggagtttgccacggacagcgtggaggagctgtttgagtggttt
cagagcatccgggagatcacctggaagatagacaccaaggagaacaacatgaagtactgg
gaaaagaaccagtccatcgccatcgagctctcggacctggtcgtctactgcaaacccacc
agcaagaccaaggacaacctggaaaaccccgacttccgagaaatccgctctttcgtggag
acgaaggctgactgtgttgtccgacagaaacctaatgatctcttgaaatacaatcaaaag
ggcctgacccgcgtctaccccaagggacagagggtggactcctccaattacgaccccttc
cgcctctggctgtgcggcgcccagatggtggcactcaatttccagaccgcagataagtac
atgcagttgaatcatgccctgttttccctcaatgggcggacgggctacgtcctgcagccc
gagagcatgaggacagagaagtatgaccccatgccacccgagtcccagaggaagatcctg
atgacgctgacggtcaaggttctcggggctcgccatctccccaaacctggacgaagtatt
gcatgtccctttgtggaggtggaaatctgcggagccgaatatgacaacaacaagttcaaa
acaacggttgtgaatgacaacggcctaagccctgtttgggctgcaacccaggagaaggtg
acgtttgaaatctatgacccgaacctcgcatttctgcgctttgtggtttacgaggaagac
atgttcagtgatcccaacttcctggcccacgccacttaccccattaaaggaatcaaatca
ggatttaggtctgttcctctgaagaacgggtacagtgaagacattgagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagcgaagaggagctttactcctcctgc
cgccagctgcggaggcgccaggaagagctcaaccaccagctctttctgtatgacacacac
cagaacttgcgcaatgccacccgggatgccctcgttagggagttcaatgtcaacgagaac
cagctgcagctgtaccaggagaagtgcaaccgcaggttaagagagaagagagtcagcaac
agcaagttttactcatag

DBGET integrated database retrieval system