KEGG   Camelus dromedarius (Arabian camel): 105085321
Entry
105085321         CDS       T04642                                 

Definition
(RefSeq) hepatocyte growth factor receptor isoform X1
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04360  Axon guidance
cdk04510  Focal adhesion
cdk04520  Adherens junction
cdk05100  Bacterial invasion of epithelial cells
cdk05144  Malaria
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05211  Renal cell carcinoma
cdk05218  Melanoma
cdk05223  Non-small cell lung cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105085321
   04014 Ras signaling pathway
    105085321
   04015 Rap1 signaling pathway
    105085321
   04020 Calcium signaling pathway
    105085321
   04151 PI3K-Akt signaling pathway
    105085321
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105085321
   04520 Adherens junction
    105085321
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    105085321
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085321
   05202 Transcriptional misregulation in cancer
    105085321
   05206 MicroRNAs in cancer
    105085321
   05205 Proteoglycans in cancer
    105085321
   05230 Central carbon metabolism in cancer
    105085321
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105085321
   05226 Gastric cancer
    105085321
   05218 Melanoma
    105085321
   05211 Renal cell carcinoma
    105085321
   05223 Non-small cell lung cancer
    105085321
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    105085321
  09174 Infectious disease: parasitic
   05144 Malaria
    105085321
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105085321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105085321
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105085321
Protein kinases [BR:cdk01001]
 Receptor tyrosine kinases (RTK)
  MET family
   105085321
SSDB
Motif
Pfam: F-actin_cap_A PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 105085321
NCBI-ProteinID: XP_031311115
LinkDB
Position
7
AA seq 1539 aa
MKSPAVLAPGILVLLFTLVQKSNGECKEALVKSKMNVNMQYQLPNFTAETPIQNVVLHKH
HIYLGAVNYIYVLNDKDLQKVAEYKTGPVLEHPHCFPCEDCSHKANLSDGVWKDNINMAL
LVDTYYDDQLISCGSVHRGTCQRQVLPPDNTADIQSEVYCMYSPQTDEEPGQCPDCVVSA
LGTKVLLSEKDRFINFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFQDTYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRRRSTKEEVFNILQAAYVSKPGSQLAKQIGANLNDDILYGVFAQSKPDSAEPMDR
SAVCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRNDEYRTE
FTTALQRVDLFTGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGLSTPHVNF
LLDSHPVSPEAIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPSFVQCG
WCHDKCVQLEECPGGIWTQEICLPTIYKVFPTSAPLEGGTTLTICGWDFGFRRNNKSDLK
KTKVFLGNESCTLTLSESTTNTLKCTVGPAMNEHFNVSIIISNNRGTAQYSTFSYVDPII
TSISPSYGPKTGGTLLTLTGKHLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTPTE
FPVKLKIDLANREINSFSYREDPVVYEIHPTKSFISGGSTITGVGKYLNSVSVLRMVINV
HEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPVKTKAFFMLDGIHSKHFDLIYVHNP
VFKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHSHSEAVLCTVPND
LLKLNSELNIEWKQAVSSTVLGKVIVQPDQNFTGLIVGVVLISIILLSLGLFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNTTQNGS
CRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKI
EGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAVESWRTSVETA
LRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQ
VVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENY
QTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
NT seq 4620 nt   +upstreamnt  +downstreamnt
atgaagtcccctgctgtgcttgcacctggcatccttgtgcttctgtttaccttggtgcag
aagagcaatggagagtgtaaagaggcactagtaaagtccaagatgaatgtgaacatgcaa
tatcagcttcctaacttcactgcagaaacacccattcagaatgtcgttttacacaagcat
cacatttaccttggtgctgttaactacatttatgttttaaatgacaaagaccttcagaag
gttgctgagtacaagactgggcccgtgctggaacacccacattgtttcccgtgtgaggac
tgtagccacaaagccaacttatcagatggcgtttggaaagataacatcaacatggctctg
cttgttgacacatactatgatgaccaactcattagctgcggcagtgtccacagagggacc
tgccagcgacaagtccttccacctgacaatactgctgacatacagtcagaggtttattgc
atgtactccccacagacagatgaagagcccggccaatgtcccgactgtgtggtgagtgcc
ctgggaaccaaagtcctgctgtctgaaaaggatcggttcatcaacttcttcgtgggcaat
accataaattcttcttaccttccagatcattcattgcattcaatatcggtgagaaggcta
aaagaaacgcaagatggttttaagtttttgacagaccagtcatatattgatgttctacct
gagttccaagatacctaccccattaagtatgtccatgcctttgaaagcaaccattttatt
tactttttgacagtccaacgggaaactctagatgctcagacttttcacacaagaataatc
aggttctgttccgtagactctggattgcattcctacatggaaatgcctctggagtgtatt
ctcacggaaaagagaagaaggagatccaccaaggaggaagtgtttaatattctccaagct
gcatatgtcagcaagcctgggtcccagctcgctaagcaaataggtgccaacctgaatgat
gacattctctacggggtgtttgcacaaagcaaaccagattctgcagaaccaatggatcgc
tctgctgtctgtgcgttccctgtcaaatatgtcaatgagtttttcaacaagattgtcaac
aaaaacaatgtgagatgtctccagcatttttatggccctaaccatgaacattgcttcaat
aggacacttttgagaaattcatcgggctgtgaagtgcgcaatgatgaatatcgaacggag
tttaccactgctttgcagcgcgttgacttattcacgggccaattcaaccaggtcctctta
acatccatatccaccttcattaaaggagacctcaccatcgctaatctcgggacgtcagag
ggtcgcttcatgcaggttgtggtttctcgatcaggattgtcaacccctcatgtgaatttt
ctcctggattcccaccctgtgtctccagaagcgattgtggagcacccactaaaccaaaat
ggctatacactggttgtcactgggaagaagatcaccaagatcccgctgaacggcttgggc
tgtgaacattttcagtcctgcagtcagtgcctctctgctccttcctttgtgcagtgtggc
tggtgccatgataaatgtgtgcagttggaggaatgcccaggtggaatatggactcaagag
atctgtctgcctacaatctacaaggttttcccaactagtgccccccttgaaggagggacg
acgctgaccatatgtggctgggacttcggattcaggaggaataataaatctgacttaaag
aaaaccaaagttttccttgggaacgagagttgcaccttgaccttaagtgagagcacgaca
aatacgttgaaatgcacagttggtcctgcaatgaatgagcatttcaatgtgtccataatt
atttcaaacaatcgagggacagcacaatatagtaccttttcctatgtggatcctataata
acaagtatttctccaagttacggtcctaaaactggtggcactttacttactttaactgga
aagcacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttg
aaaagtgtgtcagatagtattctcgaatgttataccccagcccaaaccactccaactgag
tttcctgttaaattgaaaattgacttagccaaccgagagataaacagcttcagttatcgg
gaagaccccgttgtctacgaaatacatcccactaaatctttcattagtggtgggagcaca
ataacaggtgttggaaaatacctgaattcagttagtgtcctgaggatggtaataaatgtt
catgaagcaggaaggaactttaccgtggcatgtcagcatcgctctaattcagagataatc
tgctgtacaactccttcactacaacagctgaacctacaactccctgtgaaaaccaaagcc
tttttcatgttagatgggatccattccaaacactttgatctcatttatgtacataatcct
gtgtttaagccttttgaaaaaccagtgatgatctcaataggcaatgaaaatgtactggaa
attaagggaaatgatattgatcctgaagcagttaaaggtgaagtgttaaaagttgggaat
aagagctgtgagaatatacactcgcattctgaagccgttttatgtacggtccccaatgac
ctgctgaaattgaacagcgagctaaatatagagtggaagcaagcagtttcttcaaccgtc
cttggaaaagtaatagttcaaccagatcagaatttcacaggattgattgttggtgttgtc
ttaatatcaataatactcttatcactcgggcttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagaccagtttcctaacacaactcagaatggatca
tgcagacaagtgcagtatcctctgacagacctatcccccatcctaactagtggggactct
gatatatccagtccattactgcaaaatacggtccacattgacctcagtgctctaaatcca
gaactggtccaggcagttcagcacgtagtgattgggccgagcagcctaattgtccatttc
aatgaagtcataggaagaggacattttgggtgtgtatatcatgggactttgttggacaat
gatgacaaaaaaattcactgtgctgtgaaatccttgaatagaatcactgacataggagaa
gtttcccagtttctgaccgagggaatcatcatgaaagattttagtcatcccaatgttctc
tcactcttgggaatctgccttcgaagtgaagggtctccgctggtggtcctaccatacatg
aaacatggagatcttcgaaatttcattagaaatgagactcacaacccaactgtaaaagat
cttattggctttggtcttcaggtggccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagatctggctgcaagaaactgcatgctggatgaaaaattcaccgtcaaggtt
gctgattttggtcttgccagagacgtgtatgataaagaatactatagtgtacacaacaaa
acaggtgcaaaacttccagtgaagtggatggctttagaaagcctgcaaactcagaagttt
accaccaagtcagatgtggtgcgtatagcagcaaaattcatcattcatgcccctcctgga
gaatttaatgaggtgtttaatgatgttcggttactgcttaataatgataatcttctcagg
gaaggagcagcccatgcatttgcacagtataacttggaccagtttactccagtaaaaatt
gaaggttatgaagatcaggtattgataacagagcatggtgacttgggaaatgggaagttt
ttggatcccaaaaatagaatctgtttcaaatttgatcacttaagaaaggaagcaactgat
ccaagaccatatgaagcagaaaatgcagttgaatcatggagaacttcagtagaaactgct
ctgcgagcttatgtaaaagaacattatccaaatggagtctgcactgtatatggtaaaaaa
atagacggacagcaaaccattattgcatgcatagaaagccatcagttccaagcaaaaaac
ttttggaatggtcgttggaggtcagagtggaagtttacaatcactccttcaaccactcag
gtggttggcatcttgaaaattcaggttcattattatgaagatggtaatgtccagctagtg
agtcataaagatatacaagattccctaacagtgtctaatgaggtgcaaacagcaaaagaa
tttataaagattgtagaggctgcagaaaatgagtaccagactgccatcagtgagaattat
cagacaatgtcggacactactttcaaagccttacgtcgacagttgccagttacacgcact
aagattgattggaacaagatccttagctacaagattggcaaagagatgcagaatgcataa

DBGET integrated database retrieval system