KEGG   Camelus dromedarius (Arabian camel): 105085612Help
Entry
105085612         CDS       T04642                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00500  Starch and sucrose metabolism
cdk01100  Metabolic pathways
cdk04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105085612
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105085612
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     105085612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 105085612
NCBI-ProteinID: XP_010974170
LinkDB All DBs
Position
Un
AA seq 511 aa AA seqDB search
MKFFLLLSAIGFCWAQYAPHTESGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENAVITDPFRPWWERYQPISYNLCTRSGNENEFKDMVTRCNNVGVHIYVDAVINHMCGS
GVSAGTSSTCGSYFNPGTRDFPAVPYSGWDFNDGKCTTGSGDIESYNDPYQVRDCRLVGL
LDLALEKDYVRSTIANYLNRLIDIGVAGFRIDASKHMWPGDMKAILDQLNNLNTNWFPAG
SKPFIYQEVIDLGSEPIKSSEYYENGRVTEFKYGAKLGTVIRKWDGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILSFWEPRLYKMAVGFMLAHPYGFTRVMSSYRWS
RYFENGQDVNDWIGPPNVNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVMFRNVVDGQS
FTNWWDNGNNQVAFGRGNKGFIVFNNDDSSLSLTLQTGLPAGTYCDVISGDKIGNSCTGI
QIQVSSDGNAYFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgctttcagccattgggttctgctgggctcagtatgccccacat
actgaatctggacggacatctattgtccatctgtttgagtggcgctgggttgatattgct
cttgagtgtgagcgatacttagctcccaaaggctttggaggtgttcaggtctccccaccc
aatgaaaacgctgtaattactgacccttttagaccttggtgggaaagataccaaccaatt
agctacaatttatgtacaagatcaggaaacgaaaatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccatatttatgtggacgctgtaattaatcatatgtgtggaagt
ggtgtgagtgcgggaacaagcagtacttgtggcagttacttcaaccctggaactagggat
tttccagcagtcccatactctggttgggattttaatgatggtaaatgtacaactggaagt
ggagacattgagagctataatgatccttatcaggtcagagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgctccacgattgctaactatctaaaccgg
ctcattgacattggtgtagcagggttcagaattgatgcttctaagcacatgtggcctgga
gacatgaaggcaattttggatcaactgaataatctaaacacaaactggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtagtgagccaattaaaagcagt
gagtactatgaaaatggccgtgtgacagaatttaagtatggtgcaaaactaggcacggtt
atacgcaagtgggatggagagaagatggcttatttaaagaactggggagaaggctggggc
ttcatgccttctgacagagctcttgtctttgttgataaccatgataatcagcgagggcat
ggagctggtggagcatctattctttcattctgggaacctagactgtacaaaatggcagtt
ggatttatgctcgctcatccttatggatttacacgagtaatgtcaagctaccgttggtca
agatattttgagaatggacaagatgttaatgattggattgggccaccaaatgttaatgga
gtaactaaagaagttactattaatgcagatactacttgtggcaatgactgggtctgtgaa
catcgatggcgtcaaataagaaacatggtcatgttccgtaatgtagttgatggccaatct
tttacaaactggtgggataatggtaacaaccaagtagcttttggaagaggaaacaaagga
ttcattgtctttaacaacgatgactcgtcattatctttaactttgcaaactggtctccct
gctggtacatattgtgatgttatttctggagataaaattggtaatagttgtacaggaatt
caaatccaggtttccagtgatggcaatgcttatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattataa

DBGET integrated database retrieval system