KEGG   Camelus dromedarius (Arabian camel): 105085741
Entry
105085741         CDS       T04642                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04110  Cell cycle
cdk04114  Oocyte meiosis
cdk04115  p53 signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04218  Cellular senescence
cdk04934  Cushing syndrome
cdk05161  Hepatitis B
cdk05162  Measles
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05206  MicroRNAs in cancer
cdk05215  Prostate cancer
cdk05222  Small cell lung cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    105085741 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105085741 (CCNE2)
   04114 Oocyte meiosis
    105085741 (CCNE2)
   04115 p53 signaling pathway
    105085741 (CCNE2)
   04218 Cellular senescence
    105085741 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085741 (CCNE2)
   05206 MicroRNAs in cancer
    105085741 (CCNE2)
   05203 Viral carcinogenesis
    105085741 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    105085741 (CCNE2)
   05215 Prostate cancer
    105085741 (CCNE2)
   05222 Small cell lung cancer
    105085741 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105085741 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105085741 (CCNE2)
   05161 Hepatitis B
    105085741 (CCNE2)
   05162 Measles
    105085741 (CCNE2)
   05169 Epstein-Barr virus infection
    105085741 (CCNE2)
   05165 Human papillomavirus infection
    105085741 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdk03032]
    105085741 (CCNE2)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105085741 (CCNE2)
DNA replication proteins [BR:cdk03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    105085741 (CCNE2)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    105085741 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105085741
NCBI-ProteinID: XP_010974317
LinkDB
Position
25
AA seq 405 aa
MSRRSSRLQAKQQPQPSQTDSPQEAQIIQAKKRKTAQDVRKRKEEKVTKKHQYEIRNCWP
PVLSGGISPCIIIETPHKELGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKDVWLNMLN
KETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
INKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELG
PVTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAA
ALCHFTSIEVVKKASGLEWDSISECVEWMEPFVSVVKSTSPVKLKIFKKISMEDRHNIQT
HTNYLTMLDEVNYVNTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacagcagccccagcccagccagacggat
tccccccaagaagcccagataattcaggccaagaagagaaaaacagcccaggatgtcaga
aaaagaaaagaggagaaggtcaccaagaaacatcagtatgaaattaggaattgttggcca
cctgtattatctggggggattagtccttgcattatcattgaaacaccccacaaagaacta
ggaacaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatcct
tcacctctgcctgatttaagctggggatgttcaaaggatgtttggctaaacatgttaaat
aaagagaccagatatgttcatgacaaacattttgaagttctgcattctgacttggaacca
cagatgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcat
agggaaacgttttatcttgctcaagacttttttgatagattcatgttgacccaaaaggat
ataaataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaactt
gaggaaatctatgctcctaagctccaagagtttgcttatgtcactgatggagcttgcagt
gaagaggatatcttaaggatggaactcattattttaaaggctttaaaatgggaactcggt
cctgtaacagtcatctcctggctaaacctcttcctccaagttgatgctcttaaagatgct
cctaaagttcttctacctcagtattctcaggaaaagttcattcagatagctcagctttta
gatctgtgtattctagccatcgattcattagagttccagtacagaatactggctgctgct
gccttgtgccattttacctctattgaagtggttaagaaagcctcaggtttggagtgggac
agcatttctgaatgtgtagaatggatggagccttttgtcagcgtagtaaaaagtactagc
ccagtgaagctaaagatttttaagaagatttctatggaagacagacacaatatacagaca
cacacaaattacctgactatgctggatgaagtaaattatgtgaacaccttcagaaagggg
ggacagttgtcaccagtgtgcaatggaggtattatgacaccaccgaagagcactgaaaag
ccaccaggaaaacactaa

KEGG   Camelus dromedarius (Arabian camel): 105096784
Entry
105096784         CDS       T04642                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04110  Cell cycle
cdk04114  Oocyte meiosis
cdk04115  p53 signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04218  Cellular senescence
cdk04934  Cushing syndrome
cdk05161  Hepatitis B
cdk05162  Measles
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05206  MicroRNAs in cancer
cdk05215  Prostate cancer
cdk05222  Small cell lung cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    105096784 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105096784 (CCNE1)
   04114 Oocyte meiosis
    105096784 (CCNE1)
   04115 p53 signaling pathway
    105096784 (CCNE1)
   04218 Cellular senescence
    105096784 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105096784 (CCNE1)
   05206 MicroRNAs in cancer
    105096784 (CCNE1)
   05203 Viral carcinogenesis
    105096784 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    105096784 (CCNE1)
   05215 Prostate cancer
    105096784 (CCNE1)
   05222 Small cell lung cancer
    105096784 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105096784 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105096784 (CCNE1)
   05161 Hepatitis B
    105096784 (CCNE1)
   05162 Measles
    105096784 (CCNE1)
   05169 Epstein-Barr virus infection
    105096784 (CCNE1)
   05165 Human papillomavirus infection
    105096784 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdk03032]
    105096784 (CCNE1)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105096784 (CCNE1)
DNA replication proteins [BR:cdk03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    105096784 (CCNE1)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    105096784 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105096784
NCBI-ProteinID: XP_031314402
LinkDB
Position
9
AA seq 410 aa
MPREKKERDAKEPGTMKEESGTDVPVRSRKRKANVAVFLQDPDEDIAKIDRTVRSQCGSQ
PWDSNKVCENPCSLIPTPDKEEDELVYPNSVYKPQSCTPSRASPLPILNWANREEVWKIM
LNKEKMYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDFYEVLLPQYPQQVFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEENRISPLPSGVLTPPQSSKKQSSEQETA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagaagaaggagagggatgcgaaggagccgggcactatgaaagaagaaagc
ggcaccgatgtccctgttcgctccaggaagaggaaagcaaatgtggccgtttttttgcag
gatccagatgaagacattgccaaaattgacaggactgtgagaagccagtgtggcagtcag
ccttgggacagtaataaagtctgtgaaaacccctgctccttgattcccacacctgacaaa
gaagaggatgaactggtatacccgaattccgtgtataagcctcagagctgcacaccgtcc
agagcctcaccgctgcccatcctgaactgggcaaatagagaggaggtatggaaaatcatg
ttgaataaggaaaagatgtacttgagggataagcactttatgcagcggcaccctcttctg
cagcctaaaatgcgagcgattctcctggactggctgatggaggtgtgtgaagtctataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcgacacaa
caaaatgttgtaaaaacactcttacagcttattggaatttcatctttatttattgctgcc
aaacttgaggaaatttatcctccaaagttgcaccagtttgcttatgttacagatggggct
tgttcaggagatgaaattcttaccatggaattaatcattatgaaggcccttaagtggcat
ttaagtcccctaaccattgtgtcctggctgaatgtatacatgcaggttgcgtacctaaat
gacttttatgaagtcctcctgccacagtaccctcagcaagtcttcatacagatcgcggag
cttttagatctctgtgtcctggatgtcggctgcttagaatttccctatggtgtgcttgct
gcttctgccttgtatcatttctcttcatccgaactgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccgtttgccatggtgataagggag
acaggaagttcgaaacttaagcacttcaggggagttcctgctgaagatgcgcacaacatc
cagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tctgaagaaaatagaatttctcctctcccttctggagtcctcaccccaccacagagcagt
aagaagcagagcagtgagcaggaaacagcatga

DBGET integrated database retrieval system