KEGG   Camelus dromedarius (Arabian camel): 105085843
Entry
105085843         CDS       T04642                                 

Gene name
ADIPOQ
Definition
(RefSeq) adiponectin
  KO
K07296  adiponectin
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04920  Adipocytokine signaling pathway
cdk04930  Type II diabetes mellitus
cdk04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105085843 (ADIPOQ)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105085843 (ADIPOQ)
   03320 PPAR signaling pathway
    105085843 (ADIPOQ)
  09149 Aging
   04211 Longevity regulating pathway
    105085843 (ADIPOQ)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105085843 (ADIPOQ)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105085843 (ADIPOQ)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 105085843
NCBI-ProteinID: XP_010974439
UniProt: A0A5N4EJ48
LinkDB
Position
1
AA seq 243 aa
MLLLGAVLLLLALPGHGLETTEGPGVPHPLPKGACAGWMVGIPGHPGHNGIPGRDGRDGA
HGEKGEKGDPGLAGLKGDTGETGVTGIEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLET
RSTVPNVPIRFTKIFYNQQNHYDSTTGKFHCNIPGLYYFSYHITVYLQDVKVSLYKRDKA
VLFTYDKYQDKNVDQASGSVLLHLEKGEEVWLQVYGDGENNGVYADNINDSTFTGFLLYH
DTE
NT seq 732 nt   +upstreamnt  +downstreamnt
atgctgttgctgggagctgttctactactgctggccctgcctggtcacggcctggaaacc
actgaagggcccggagtcccgcaccccctgcccaagggggcctgcgcaggttggatggtg
ggcatcccggggcatcctggccacaatgggatccctggccgagatggcagagatggcgcc
catggtgagaagggcgagaaaggagatccaggtcttgctggtcttaagggtgacactggt
gaaactggagtgactgggattgaaggtccccgaggctttccaggaatcccaggcagaaaa
ggagaacctggagaaagtgcctatgtataccgctcagcattcagtgtaggactagagacc
cggagcaccgtccccaacgttcccattcgctttaccaagatcttctacaatcagcaaaac
cactatgacagcaccactggcaaattccactgcaacattcccgggctgtactacttctcc
taccacatcacagtctacctgcaggacgtgaaggtcagcctctacaagagggacaaggcc
gtgctcttcacctatgacaagtaccaggacaagaatgtggaccaggcctctggctctgtg
cttctccatctggagaagggtgaagaggtctggctccaagtgtacggggatggagagaat
aacggggtctatgcagacaatatcaacgactccaccttcaccggcttccttctctaccac
gacaccgagtga

DBGET integrated database retrieval system